Table Of Content.
WE CAN HARDLY Boulevard Cleaners to Close in March
WAIT...
After more than 35 yearsofservice local drycleaner.
tothevalley, MaryOlverawillcloseher
Boulevard Cleaners and Dyers in Aboutadecadeaftertheywere mar-
March. Regular customers will be ried, the young couple opened their
asked to bring in their apparels and Boulevard Cleaners at 10 Raymond
other fabrics by late January to both Ave., which despite being located on a
assure attenive service and allow the predominantly residential streetquick-
business to properly wind-down its ly found a core ofsati°fied repeat cus-
operations during the month of tomers.
February.
"Qualityiswhatcounts,"onceproud-
Cleaning has been a way of life for ly touted Adolph, who longadhered to
Mary and her late husband Adolph, asystemhiswifeand hetermed "theold
whose untimely deathofa brain tumor fashionedwayofdrycleaning." Offend-
morethanthreeyearsagobroughtsad- ingstainswere inquired oftheirorigin,
nesstotheirneighbors. after which great skill, attention and
patience were applied for maximum
"Adolphhadawaywith people,"said cleaningresults.
Mary. "People came with their
problems. He would teach people "WeVehadcustomersformorethan
25 years," said Mary, whose clientele
something."
even patronized Boulevard Cleaners
Coach Dan Harrington's Wilson Warriors varsity baseball team is Mary was living in Bakersfield in despite moving from Visitacion Valley
1945, attending a beautician school asfarawayasConcordorSanta Rosa.
bravingthecold,coldwinterbykeepingplayingskillssharpinanticipa- when she met her future husband, a
tion of an exciting 1993 season. MexicoCitynative, thenemployed bya "I consider my customers as a big
family."
After 27 years, the business was
forced to relocate at 168 Leland Ave.
when the Raymond Ave. buildingwas
sold. Their two grown children, Anna
Marie and Henry, also assisted at one
time with the grueling six-day weeks
which sometimes lasted more than 12
VISITACION VALLEY hoursaday.
"Wewould like to thank all ourcus-
- tomers with gratitude for their
patronage all these years," said Mary.
ISSUE #78 SERVING OUR COMMUNITY JANUARY 1993 "Wehaveenjoyedservingthem."
A LOOK AT THE YEAR AHEAD the percentage that can be charged. I My proposalwould have expan ded
will also be exploring otherconsumers the definition of "public meetings" to
uL,y... S7u-1n.n- tJ-,. DDUflO.T—if fAi&Scmt/LiIy.m»e/riwUeaip twhoerfkiirnsgtowfitthhebyuesairn,eassndanwdecwiolmlmceonrtcienuteo in the marketplace. iinncclluuddeesmepeutbilnigcsoofffiacanlys garnodupspwehnicdhs
' teaohbvceeooWrruneittothimosehuiosrcentefphauaettsnhutdirmfneaegpaowntplmhyipoateiniacctCrahhalasulni,necfgnmeoervrastniniiryaaoinnntn.shmioceBnaunugnttrs seeDItiemnneznjapmzuscldratometybadielutoorwsnnisoa,gnrsot-ekveotssesesmtrreoensmsmvo,.mtetuombsoseumguttaatolnhilioxa-unfmvngasuedftnseauaattrlef.mbaoreeirreafacil.oaousrrvmmmgs--.e- cpletaordurrounsEejctsevaitctnebotiuynioeeonpnnrattssilohouorarpniurerteegoiehzttddiehisncansgttceaooxorauutleurlrraymesgeectidahtnuuri,gdc'l,easdnitrwtniebseconul'numbdsddaugiosfselniutt--cg wpgtauoanobxudvlpleiardrceyntefamrruleesnanfodttussian,hndlecasllnadudfudobterpyhrpopiorhfuvifobatitlncyeieaclgoscrsroeoonrrusvfppigecserreonesgudn.ipicvsnee.Isngt
counton;theirelectedrepresentativein exceptional students and studentswith Pubiicofficialsand thosewhospend
the Legalslaturewill continue to focus Because of these bard economic special needs. taxpayers'dollarsmustunderstandthat
onourstate'seconomicclimate. times,consumers'dollarsarealsobeing the current economicdownturn trans-
stretched to the limit and beyond. My Democratic colleagues in the lates into a corresponding drop in
State revenues again fell below the Helping consumers get the most for State Assembly and I continue to be revenues available to state and local
Governor's estimates. From July to theirdollarscontinuestobehighonmy committed to cutting bureaucratic governments. Prioritiesmustbesetand
October, collection of personal, sales agenda. I intend to pursue legislation, waste wherever possible to ensure the the public must be involved in setting
and businesstaxeswere appproximate- once again, to keep bank and other maximum possible funding for educa- them.
ly$300million lessthan Department of creditcardrates reasonable by capping tionwithinourbudgetconstraints. continued on page 3
Finance projections. If December's
rteimvaetneudesS7fa.l5lbbeillloiwonprcoajsehctsihonosr,tatghee efso-r Here's What's Doing in the Parks during January of the New Year ifnintaelrersetsitnigngppeloapclee-opfrem-aCniyviflaWmoaurssaonld-
theRceucrorgennitzfiinscgalthyaetarthceoeulcdoninocmryeamseu.st SBAATKUREDRABYE.AJCAHNUARY2 and9aS.umn.da-y7,pf.rme.e:aPdsmyicshsiicoFna.irS,.FS.atCuorudna-y dtDihreierrsst,sya-wfUoaunrrmiloMyne.dsapRyl,aioafnnHcIoannndcioealrns.srecco1iu0pt:i,0en0atnstd.o
bctoeonboveeugnritnefidrtsahtenpsrptiraootriecte"ys,EsctohonefomSoupiteclaiSknueimnrmgihtaan"s milSiteaarcyoasotf BDaetfteenrsye:ChamEbxeprlloirne atnhde tF0y4oF3ra6imroorBrl1de-g.5i,1n09f-to5hr4mA8a-vt8ei0.o2n0a,.ndcaLllin1c-o5l1n0W-5a2y4.- e1n1:t3r0anac.em.gatMeeaeltontgheLiwnacloklnleBaoduelreavtartdh.e
eeccoonnoommiycasntrdatpeugtyCtaolriefbourinlidaonsurbsatcaktet'os wiantcchhdaisdaepmponesatrriantgiornifolef.the12l:as3t0sitxo- Str1y0bian.gm.Nu-rs1erpy.m.a:rePal,anltocSaatleed iant tthhee 0R8e6s5e.rvations required; call [415] 556-
wiaontcrook-nasfeoTnchuuessoosunurmtemhcieotnnseohcmoeiuscsladiirlsyheaslntpdepbsbr,uiinlidgt CB1aa:lt0lFt0peO[.r4mRv1.5T]ChMP5a5eOm6eI-bt8eN3rTa7l1ir.anngaetrBaatktehre gBaetaecht.o sPjlooaiunnttihsnw.getshtTehGceoarrnSdeterrnybooiffnCgtahleAirfGboarornrideaetnNusamtiavd&-e tBhrriCedoega-esmittlaoelBhaDikekeefrefnrBseoeamcHht.ihkeeEG:xoplldAoernescGreaentmi-ec
wafttiuacollllawlidazeieranodmnciudldcruedcleveoeceamlosdponteploarietmsnetywge.bhauoaspgiwlneoaenunsdslat,doalehanxebdalompriwrnoaeevrnidka- ctFaaarnlnadeFdnslocaerrio-ttsflicliPslotooewirlhaydnilistcketaroCtssrah,eynr.mdolaluitEeggexlhshpit.lgFhohootrDurerstTeeogPssuuosrinan:wntta,durOrmhrSnleeayatn.ars ABPaavobrteok1a.u.ntpia.ccnmaa.dll:eLGCniaadnalrcredosnlednfnarsWroamiWsyoalrroiknocsauGthnoeodldpdt.neheenaLwrGeoaar9trltenhd nWat1tea:ar3nitr0tehssteIoIfo.3Bfr:ao3Dthm0trieseptrts.hoymser.iEwcalaMSsrc7etom0eal'pstysat.arttlkhhieRrdnaopegiuafngrelhoknctsarWenaaocbnerboglalvestde-.r
opprlniaeoWnroiofrtfoikretesohr,uesr'akssetycawtolpeml,ipeaceanesndssoiaotftfiisatoohnnneyereAoecsffosmoneryommmbtiloicyps 6qu:i3MWr0eiAdnt;RotecIa8rlN:lB3iH0[r4Ed1p5i.A]nmgD.55AL6d-AvR1eeN6ns9Dte3ur.Srveast:ioWnsatrceh- yywa1seoo2l:uui3crn0iosnomtaerwmsu,ancskbtpifuoaortncrgecJha1tiin9swla9od3ilr.isemSpinoeStucueiidtng.ahndl-wecAuorlaprellstiehgabnhgedtaegassirmsnsiuassrotatefst FR08oe6rs95tea.r.vPmao.tiin-ot5npsa.lmro.e:nqgWuaiLrtiecndhc;oalcaanlnldB[oe4un1lj5e]ovya5rt5dh6.e-
pDreredemmoticaurpmeasth,iacvrealaemlapldacenrotsmhbifiprn.aeuddSktaoynrdmoacekknedetlietsnhsge tsLhaaeugnoatonetnri.icnsLgeoafarronouuwrnhwdeirnRetoetrdheemyoigtrrBaaevnaltecsdhwfhraionlmde SbM3euaspceercuompmeprWasanoyin..edFRboayrnadmnaolarldeuMlitu.nsfTeohrumema,tfieo1en9i,9s ScBuaallnabroFDarraSinvtceai.dsicuom,SoHcacveerloLcekagStu.eanpdlaCyira-t
sneyssstLeaessm.tayebaurrdweenptroeCsaelnitfeodrntihaenGsobvuesri-- acg1suo1i:mwd0eee0!lslaa.nmtH.dheeabyMivenayoerceturlabgaiiornrisdn.cgae.BnnceteghBliusisn.rindaeisrn9tsg:P0We0betilret-dro ScdaaUlylNf5D5r4Ao-mY96,1000J,aA.TmN.ueUtsoAd5RaypY.tm3.hrough Satur- .gsfeerraoDvtuuaunrtsdioknr:igysAaoVnaltlirvlgeieheetywweidaettfahlctoahhreasletevahaerosnlitiinendragtnyhiepnelbnCaadoqcnuko--ef
wnoorrkweirtsh'acroemapsorneabfloermpalcegkiasglaetioofn,soamned CReitnstoenraptatrhkeinMgarliont HeRaedsleravnadtsioVnissitroe-r MARINHEADLANDS JP.aFr.leKennedy Drive in Golden Gate
hreemsahionulcdomhmaivtetseidgnteodwiot.rkHionwgevwietrh,twhee quiGreuda;rdcailaln[s41o5f]t3h3e1G-a1t5e4:0.Takeapeek as RaoscokleditesrtwohRialnegyerosu:eIxmpalgoirneeasneravnitnig- WEDNESDAY,JANUARYo
Gvernoronthisimporantissue, andwe aatndtheguhinsteomryplsaucrermoeunntdisngofthtehebuMnakreirns atierecrrsafitntmeirspsrieltetshietee.raSatnadffexapnldaivnowlhuan-t MARINHEADLANDS
iatmrhnreaitesnseoaaynusgedreaeotrmfpoewrnphortrtieee,cgcshuetelicgnaotootneno.hsoriymemivcrweeinitfnfhocurelrmnett,ghievgiressril,onatwatitnhohden oHtMtfhheeeeaetdhtNMleiaamknrifeidlirisnsmt.tiasreHHsyaeiehralaietdsrhltewasorontraro.ydrksbi1uebV:sfai0ftfs0tpiretatorouomylr3tt:cCh3huee0rrnordtpuyae.gyrmah.s.t atp8i8aofrnooPkarnRlsmtEFepaiSfarefrIlkmadD.inIsRdsOoi1Nal2ied:k.3be0avCstaeeoltlei3sr:[a34dn10os5i]pan.tg3m3N.i1in-k1Mae5e4snei0at.t-e tlttoohisemtrWeeweMsoadtaftnryaeeiernnasdbrdiaHarasdegystaaoidcfnuloonarwmdnhetdehlstoen'ocaBaRlmlilorobdtdsishret:edoetrriILsetr.a'oesdgwJtonaohoeniadndtn
We expect to reconvene a bi-par- Reservations required; call [415] 331- Presidio Cemetery Walk: The San bird watcher as he roams the park in
tisanworker's comp forceshortlyafter 1540. Francisco"National Cemetery is the continued on page 7
\
G*«pnf||K
2 JANUARY 1993
which time he began toinquirewhy she
Letters was in the area "in which this incident
tookplace. Hesummoned Mr. Ishmael
3urch. Maintenance Supervisior for
workscheduleinformation;foraccord-
Dear Editor: ing to Ms. Carter'sjob description she
was a groundperson. Therefore, Mr.
The Geneva Towers management, Fleming, could not understand why
csCdieooscnmtutorpariaittnneydeydstfaeaneifldnfcyaeoonrmdurproenltel"hoeeMudesJstosoiharnngfeeosSsrptmoeanfwtdraiorotmnto MMithnssac..tidCMCearanrr.ttteeBrruArcwwccaahossrpadrtaiosntvsghiiegdtneoledodctMahrtteh.ieosFnciohrouemtfdisuntilghd.eee i t - . ,•: / i•• •.•<(•« k>-iy'Xv^
GenevaTowers" article. ground area as her areas of respon-
GenFeirvsta,TtohweerresaArepanrotmsiednetdsoootrheerxittshaant sibility fortheday. At that point, itwas
determinedthat Ms. Carterwasoutside
Secured emergency use only. All resi- of her assigned area. This been a con-
sdatenrndutcsteexaidntdsonsftratfohfemihraGvueesne.ebeveaTnhTeporoewpneetrrrslayncaiernse- spsetalaslntetdmpocronontbshlisestmeawnntidltyhsMfhoser.htChaaisrstvbeeerreyonviecnrforutanhc-e- r> -:vv Vr
tsSelhrdrSgvoefeucidgorhneadfdplroypoo.rnrtoMalescxoi.hbtibTtvnoigdnGoaaotrrhWrse.iastsotonustShwtsarisedeetobbB-y datMiesotc.neo.rnWAvmafeitrtntseeasrdtfitauohnrnatdthteMOarsfk.ifinniCvgceaesrrpttliegakracetenoidvoabnel,erlthitweaweanaerdsdn ) * V
OSefcfuiricteyr. MO.ffiKceerndKaelnldalwlitahpprBoeaicjhiendg doewcnidepderosnonhaelrorwenastoonisn.terBveenceaufosreheorf i ' 1 'Jr'\~
pMrso.peWratextistdaonodrsi:nsftorrutchteeddohoerrsuhseewtahse wnuermeeroofutsheinSf3rmaectisoonrst,. Msso.meCaorftewrhwiachs t&W$Mi miss?
attempting to activate [fire alarm- IS,
eOjqoruneviuepsrpeseadot]nolnyf.,orDMesux.ritinCwgyanstthhefioacrouCeramsreetregorfenatcphy-e terSAmirintncaheturelrdy..Hutton. j< ' ' I~1,lk •! r?*i j'?H f^f• \ ttfl k3j.
parently overhead the instructions cc: William Hutton. Property Su-
given by Officer Kendall. Ms. Carter pervisior
Sharon Brown, DirectorofFamil-
immediately commenced to chastising
Housing
the officerfornot makingan exception ly
atotttehmeptrulaet.diOsfcfoiucreargiKnegndaMlsl. mWaadtetsana Dear Editor: > i %v; ;q. > ; rC»; ^Q. y-r.\ v- '?-o ?'[J >' v v-'p vp ,,
secondtimefromexitingtheemergency With the help of our schools should be institutions of theSupenntendentonacomprehensive
doorbyreiteratingtheinsu-uctionsfor- severalpublicinterestlawfirms, such as education rather than alienation. The package to co-loacte community and
mally given. Ms. Watts was advised a SanFranciscoNeighborhoodLegalAs- recent gangviolence involving increas- city children's programs into our
:hird timeofthe prodcedure forexiting sistance Foundation, Mutlicultural inglyyoungerchildren, and the 14or 15 schools. When youngsters have dif-
the building. Again. Ms. Carter lashed Education Training and Advocacy, yearoldscommittinghomeinvasionsor ficulties,ratherthanexpellingthem, the
outwithabusiveremarksatthesecurity American Civil liberties Union of carjacking should not be a surprise. schools will rely on these children's
officers and began to encourage Ms. NorthernCalifornia,BarAssociationof Whentheseyoungpeoplewerepushed agencies for services to help these
Wattstothesameas Ms. Carter began San Francisco. Youth law Center, and out by our schools, the streets became youngsters while in school. Again,
ro distort the exiting procedure, i.e., Legal Services for Children. I have their teachers. To help these thankyouforallyourhelpand support.
thatitwasokaytoexitouttheemergen- finally moved the School District to youngsters,theymustbeinourschools. 1 trulydrawstrength from knowingthat
cydoors. As the securityescorted Ms. decrease its number of student expul- I am firmly committed to keeping our youtoocaresomuchaboutourchildren
Watts to the proper exit area. Ms. sions. Lastschoolyear, the Districtex- expulsion rate to the absolute mini- in thiscity. Thankyou.
Carterfollowedcontinuingherabusive pelled an average of 26.5 students per mum. The next step will be to address Sincerelv,
ldaunregsu.ageBeacnadusdeisMtsor.tiCoanrtoefrexiistapmraoicne-- mtoon2t.h3.3 sTthudiesnytesa.r,AtsheI ahvaevreagoeftiesndsoawidn. wtihlelbneeewdosrokfintghewsiethtrtohuebnleedwsBtouaderndtsa.ndI LBeolaarnddoVf.EdYuecea.tPiho.nD.Commissioner
tenanceemployee, theincidentwas irr-
mediately reported to the Director ot
Maintenance, Mr. Larry Fleming, at Celeste Carter Christine Drummer. Well we entered the KWANZA
Trameka FulbrighL Nicole Johnson. Celebration at one of San Francisco's
FiveYears Ago inthe Natisha Evans and Charles Toll per- most beautiful socialite's home,
formedtostandingovations. MTV. eat JACKIEGARRISON. Whatagala af-
Grapevine
yourheartout. EairiUI! Itwas a who's who event..The
SPECIAL THANKS TO FLASH KWANZA
JANUARY 1988 GIRLS FOR DOING AN EXCEL- fUirMstOJprAinc(iUpnliety)o.f tThoe strive for anids
* Nine acres of land on the north LENT JOB IN 1992- maintain unityin the family community
slope of San Bruno Mountain next to Ethea Lucas. K.e\inaMitchell. Bran- nation and race. JACKIE'S party ex-
the parkwere rezoned in a unanimous dy Alexander. Christine Drummer. emplifiedthetruemeaningofUMOJA.
vote bythe DalyCityCouncil. Damsha Mitchell. Ayesha Benson. FYI - "NGUZO SABA" The seven
* After much hard work. Bay Area Ramea Lucas, Angela Saulsby, and principles ofthe KWANZA - DEC. 26
Mountain Watch volunteers collected Chanae Benson. Cbanae's mother, -JAN 2:
6,000signaturesfortheCaliforniaPark Cheryl Benson is the Mother of die
aCnadmpWailidglnif,e(eCxaclePedAiWn)g BthoenidrIcnoitailatibvve Shirletha Holmes-Boxx rMhoenStohulfTorraDiencDeamnbceer.shoCwheirnygluswawsMhaCatt KajichaguIl'imao-jSael-fUdneitteyrmination
1.00*0.Surrounded by a lake oflollipops, HAPPY NEW YEARS!!!!!!! iHtaimsmleikre'sto dapnrcoefelsiskieonoanle ofdan- Ujimraes-pCoonlsliebcitliitvyeworkand
h12o5urpsouonfdswoorfksuwgeanrtanidntmootrheetwhiannni1n0g0 ConstLeatn'ts loMooktbiaocnk otnoo19k92you to cdearns.c.e.CflHooEr.R.TYhLawnaksscfuotrtitngheupsuoppnortth,e KuuNmiaba- P-uCrrpeaotsievity
entry which earned Visitacion Valley Amsterdam in the Netherlands - you Cheryl Imani-Faith
CommunityCenterfirstplacehonorsat were able to see the Red Light District
the Coyote Point Gingerbread House whereanythinggoes -women standing HUMTEKS POINT
Competition. in storefront windows selling their
* Schlage Lock employees showed bodies legallv. drugs beingsmoked and SHIPYARD PUBLIC MEETINGS
theircaringattitudesbydonatingatotal sold legally and the BULL DOG Cafe
of$84,848totheUnitedWayoftheBay whereyou receivea menuconsistingof
Area. differentkindsofmarijuana Veryin- Mayor Prank Jordan and the Mayors Hunters Point
* Visitacion Valley Elementary teresting tnp....the irony is that bike Shipyard Citizens Advisory committee invite you to
School received a Distinguished theft is the major criminal act or participate in a series of public meetings soliciting public
EfrloemmetnhtearCayliSfcohronioalSAtawtaerDdepfaorrtm1e9n8t7 theTrhee sWoCmuCchGfiorrlpsroAhigbaiitniosnt!!!G!a!!n!gs cisotmhmeenstcheadsuploeteonftniaeliglhabnodrhuosoeds maetetthiengssh.ipyAalrldm.eeBteilngosw
ofEducation. (GAG) featured several pep talks to will begin at 6;00pm to 10;00 with the exception of the
their teenaged counterparts covering meeting that is to take place at city hall.
everything from AIDS to Gang
Violence. They also took uswith them Downtown Comm.
VISITACIONVALLEY to the SFPD/Gang Prevention spon- Thursday January 7, 1993
College
EDITORIAL COWITTTE sored Wilderness Program. Gigi. Sun- 4th & Mission Sts.
shine. Princess. Monica and others
LenAppiano JulieKavanagh
BDVooinnnncBieeenrtBtaComhnbeauorg AnLnaBeVraeKunadgaahrntLuoKnipenengz wceonurts2e5atfeGelten+Pianrkt.heTahireyonaltshoetRoookpeuss Thursday January 14, 1993 PFoerlttoolna&ReHcolCyeonkteerSts.
WalterCorbin FlorencePevtherer riverraftingattheMotherLode. Great
PatCrocker JosephPorter waytospend a safe and drug free sum- NOTE: A citywide public meeting is tentatively scheduled to
SMrlethaHolmes-Boxx RvbySmith mer. WCC take place on THURSDAY JANUARY 2& 1993 at city hall.
PVAvuaebl.llie.syShaeCndoFmrmmauonnncitithsylcyoC.ebCnyAte9tr4h,1e34V5,i0s<iR6ta?ay-cm6io4on0nd0 tooTkheoff with FtlheaisrhGmierslssa(gaegsest1o1t-h1e4i)r People with disabilities should feel free to contact us
ExecutiveDirector: Julia A.K?v?nagh peers advocating education, drug-free regarding any resonable accomodation we may be able to
Opinions expressed in the Grapevine lifestyles3ndotherissuesthataffectthe provide so you can fully participate in the meetings.
dVoisinottacinoencesVsaalrlielyyCormemfulneicttythCoesnteero.f wcihtihldareJnr.ofStooudlayT.raTihneDyaenncdeedwhtehereyeianr- PSmlietahseatcon7t4a9c-t502M5r03W.ilbePrlteaBsaettcloentaatct74us9-2a4t62leoarstMst.hreReanddiays
vited guests such as Cynthia Williams, prior to. the meeting date of interest.
JANUARY
1993 3
A LOOKATTHE YEAR currents W3ve of "carjacking" in this
AHEAD stateisthenewestexampleofthis bold-
ness. I have developed a package of
L. Kirk Miller AIA from page 1 ltieegsisfloatriotnh,isiinncclruedaisnigngilnycvrieoalseendt pcreinmael,-
I, therefore, intend to reintroduce to help stop these parasities who prey
similarlegislation tbissession, and Iwill on the honest, hard-working men and
HOOD MILLER ASSOCIATES work with the Governor's office to at- womenofourstate.
tempt to address his concerns. How-
ever, given the severe budgetary con- These are just a few of the issues I
Architecture 60 Federal Street ssttrroanignltys btehlireovuegthhoeuste ignodivveirdnuamlesnmtu,stI iLengtiesnldattiovepusressusei.onA,sIwaembehgoipnefthuel 1t9h9a3t
Panning San Francisco 94107 be held accountable for the public dol- the changes in our national leadership
Urban Design Telephone 415 777 5775 larstheyspend. will help unleash the best in alll of us.
and look forward to working with the
Wemustalsostayaheadofcriminals Governor and my new legislation col-
whohave become more and more bold leagues to meet the challengeswe face
intheircrimesagainstourcitizens. The in the newvear.
JAMES PRESBYTERIAN CHURCH
ST.
COMMUNITY BOARDS OF SAN FRANCISCO 240Ldaiul Avenue SanFrancisco, Ca.94134 Telephone: (115) 5S6-6JS1
SERVING VISITACION VALLEY
SINCE 1976 Hie Rev. Dr.JerryO. Rcsils Minister
Church School Clnssos -9:15 a.m.
Are you involved in a conflict? Sunday Worship Service - 10:30 a.m.
Resolve it peacefully at no cost Wednesday Bible Study - 1 1:00 a.m.
For Information or Assistance call: [•Yiday ColL^c RiMo Fellowship - 7:30 p.m.
Saturday Choir Rehearsal • 10:00 a.m.
863-6100 YOUarecordiallywelcometojoin usfor study,worship, fellowship and
service. We seek to leach the Bible and to lilt up JesusChristso lie can
SE HABLA ESPANOL draw all persons to Himself.
(X>METO CIIDRC11 THISWEEK.
&
Panda Restaurant Cafe
PALACE PHARMAC]/
2800 Geneva Ave., Daly City, CA. 94014
(415) 467-5232
VISHACWN VALLEy PHARMAC)/
100 Leland Ave., San Francisco, CA. 94134
(415) 239-5811 $11 amua* BREAKFAST * LUNCH ' DINNER * CATERING ' FOOD TO GO
OLIVER LEE, pharm.d.
JOHN PH^M.O. % tl & BMMia± 73 Leland Avenue Open Mon. thru Sat.
585-6419 8:00 a.m. to 8:00 p.m.
FIRST CHILDREN'S CENTER
NEW
A START
a warm and nurturingenvironment
HAIR STUDIO
to help the child grow
in selfesteem and social responsibility
• Openregistration-enrollment
• Afterschool extended care
SPECIALIZING IN COMPLETE HAIR CARE
• Please visitourcenterto sign op
Men Women
- - Children
The center opens each week day 120 Lathrop Ave,
7. A.M. and Closes at 6:00 P.M.
San Francisco, Reasonable Prices
Classes for 2 and 3 years olds:
Ca. 94134
Classes for 4 and 5 year olds:
Classes lor Kindergarten.
(415)468-4055
CALL
an appointment
for
COME
or IN
(415) 584-3077
222 Leland
St.
San Francisco, CA 94134
4 JANUARY 1993 <H«<'Ul
scheduledSaturdayperformancethere trailer, a sort-ofMa Kettle type,whose going nowhere, often ended with
wasnothingtobefound. sixgrownchildrenfromapreviousmar- surprising results. His smashed-up
remember storming out of the riagemadeup the restofthe Del-Ray's stovepipe bat occasionally caught on
houIseveryearly thatSaturdaywithout handsandperformers. fire, theatrically exinguished by one of
even so much as a piece of toast for Somebody must have gone out and theringcrew.
breakfast, and peddling like a madman givenBunnyahandwiththings,because All in all, the entire show lasted
WhAennartrhoewCtiwroc-ulsanCe&ayrmoGaiedn^sttoxilTalmcoawRrrenides orsahtoatvazoedsapr,erpvdteIeoldcryoatoluahnlerdrhofialissdneelbgedie.bkdtaehtFaitbntreyroTatemohdceniaryftcerclwnaeuciarllesvie,keraessltisrnaheorataimphdne-eyg wweaptvalaaesscrtehwfyiietsinlhnelicntwiihgenrecatputholshaa.petcerewnDtabahesyialrtn;g-owoRloieaunnecy.gkkeyatnNcofdtoo.bireobtnishgetettomeuonpiktt wccstiaaaoaslslmtiewfpcthrebheeyrein.fnnogcoAroralnmmrtsaaohinludocsneuetrdgsaehn4dd5wfateomrhuradirtsne,utnthebseeautsrtaa,lgdvyneme-oirdidtysesstfniphtaoeainn--t-
sparse traffic from the old highway to sort of a wagon train defending itself Every kid in town, and then some, weekend,manyofthetownspeople,and
the business section of Springtown, a againstanattack;mostlikelythatwould was crowded onto these rickety old nearly all of the kids took in all four
pleasant little California town just far betheskepticalaudienceturningupfor portable bleachers arranged around a shows. Sunday's final performance
enoughawayfromthehustleandbustle theshows. singleringwithjustenoughroomlefton even had a standing-room-only crowd,
ofurban American life,yetnottoo far In the middleoffield amongsta dis- thefarsidetoallowtheactstoenterand enough to delight any group of per-
buriedintothestickstobeoutoftouch array of miscellaneous circus-type exit Andwhatactstheywere! Nothing formers.
with reality. Quite a fewyears had past things like ring sections, disassembled fancy, mindyou! Yet when the shows were finished,
since I lived in town, but many of the bleacher seats, and a bunch ofcircular Dressed in bis stylish P.T. Barnum nearly all circus personnel seemed to
houses Irememberedwerestillpresent platforms painted in the same, stylish attire with a bright red tailed coat and hidebackin the trailers, perhaps afraid
as I drove across the old bridge at the motif as the poster, was a sloppily bigblackboots,Ray,assistedbyasome- to get too friendly with the locals.
creek and turned onto the side road dressed, befuddled looking man with what scantily dressed Del in an outfit Everyone, that is, except Bunny, who
which would wind around the large his suspenders banging down and lookinglikeitmighthavefitherproper- had a much more grotesque batch of
field. severaldaysgrowthofbeardonhisface. ly sometime in the distantpast, started jokes for some of the adults, as he
Suddenly, I became disoriented, as Adjacent to him on the ground con- the show by inviting a few of the kids poureddrinksin backofhis trailerand
house after new house obliterated any spicuously half-wrapped by a dirty into the ring and asking their names, laughed up a storm.
sign of there once having been a large striped shirtwas a bottle ofsomething after which he'd announce ficticious Early that evening, after the last of
openarea. Legendhaditthat a profes- withastrangelookingbirdon thelabel. onessuchasRoscoeorLullabelletothe theaudiencehaddeparted,athorough-
sional minor league baseball team bad Although it was still quite early in the restoftheaudience. Each kidwasgiven ly inebriated Bunnystaggeredfromhis
onceAused the area asa springtraining morning,hemadeahabitoftakingcon- a specially made balloon animal,which trailer and began the taskofdisassem-
site. decrepitold backstopdid sit for tinualgulps outofthat bottle, followed the ringmaster seemed quite adept at bling the ring. Tire tracks, hoofprints,
yearsinafarcornerofthefield,butnow by a cough or two, and then the in- creating. andabunchofpeople'sstoriesonMon-
everything was gone, replaced by evitable resumption of that puzzled NextcamethehorseacL..er...Imean, day were the only evidence something
several new house-lined cul-de-sacs pony acL Space conscious Del-Rays had gone on in that field over the
look,
withstrangenames. "Excuse me mister," blurted out opted for the smaller animals which weekend.
It took a few moments, but I finally Tony, "but is there going to be a show werejust as popularwith the adults as Springtown'sweeklynewspaper, the
got my bearings straightened out, today?" withthechildren. Fourlittlehorses ran Review-Tribune,operated bycrotchety
thank*toanoldoaktreewhichsurvived "You bet,sonny,"answered theman around the ringto pre-recorded music oldCyrusVonwog,ranaspecialfeature
the changed landscape of what had withawidegrin,ashecougheda couple as Ray simultaneously talked to the about the performances on the front
once been a familiarstompingground. moretimes, and then took his compul- audience, smoked his cigar, and page, completewith pictures of Bunny
I stopped my car where an old green siveswigfrom the bottle. directed the less-thanspectacular leaps on fire and one ofthe poniesjumping
fence once stood bordering the No sooner did he wipe his mouth overthelow-lyingobstacles. Peppy the overatwo-footobstruction.
perimeterofthefield. I hadstopped my thananirratewomaninherlatethirties Pony, blind in her left eye, but decked Nobody ever heard anything ofthe
bicycle on that very spot as a youth with a ton of ugly purple mascara and from head to hoof with ribbons and Del-Ray Circusafterthat Therewere,
minagnaynydeagrosinaggso-otonrpeoasdtealdlttohethaedvweortoids:- trroauilgeerdswteoatrhienhgilatdhairdteeodusfrsopmaroknleeogfretehne Asltlrefaomuerrsp,ownaisesclweearrleyutsheedfabneffoarveoriatned. nevoerm,ofroertshhatowmsatttehre.foAllnodwiynegayresarla,teorr,
Grand Fiesta Picnic; Springtown Bar- robe. She puffed frantically on oneof afterthe performances in a ridingring, therewould be no field.
beque; the Del-Ray Circus...ah,
those extra-long cigarettes as she a bighitwith thesmaller kids.
yes...thatonebroughtasmiletomyface. pointedoneofher brightly painted red Next came the acrobats, jugglers,
1wasridingwithmyfriendTonyand fingernails towards the fence and andhighwirewalkers (okay, sixfeet off HolidayCard Recycling
wtaecksepdo-tutpefdortthheecfoolrotrhfculomiponsgtDeersl-jRuasyt sthhirsiaefketde,rn"oTohne,res'osynoousbohyoswshheoroe,'sthilotow!o" tcohuentgsr,oruingdh;t?)bwuitthita'ssutchceesstiaolnenotfptehra-t Like cut holiday trees, holidaycards
G'rcus. Well, with Vampira directing the formancesseeminglyaimedatduplicat- create wonderful sentiments but they
com"iWnogw,he"ree.xcLloaoikmesdliTkeonity'l,lb"eaacgirocouds woauyt,oTfotnhyeafniedldIhasadquliitctklelytoasdowebuctourlidd,e iEndgsSoumleliovfantheShfionwe;rsstpunitnsnisnegenpolnattehs,e atriemeecoofloygiecaarllyyowuastteofcuhl.basIfethwiisthis otlhde
one." both a bit petrified, but still laughing flying pins and the such; but which friends and don't want to give up the
Actually, if a person were to judge about the great reception given us by seemed to be executed a couple of tradition, buycardsprintedon recycled
performancesbytheircaliberofadver- thenewcomers. notches higher than talented kids paperandrecyclethecardsyou recieve.
tising, then the Del-Ray Circuswas in- Wewereto find outjust hours later bouncingupanddown on the bed. Each year, Jack Earl)'provides a list of
deedagood show. Hystericallysmiling thatthescaryladywasnoneotherthan Then came the dog act Several places that will accept used holiday
clownsanddancingshow horses added Dolores, the Del of Del-Ray. Shewas breeds and several muts running cards. Thesegroupsusethemforsuch
the frosting to a presentation ofjug- married to Raymond, or Ray, a sort-of aroundtheringinfriltyrainbowcolored thingsas teachingandfund raising. To
glers,strongmen, and acrobats. Surely crossbetweenGaryCooperandMilton clown outfits, complete with the recieve your list of addresses, send a
the field was more than adequate to Berle, ifthere could be such a person, pointedhats. Onewasactuallytalented self-addresses, stamped envelope to:
accomodatethelargetentandquarters who smoked a big black cigar like enoughtobravethedangerofleapinga Jack Early, All-YearChristmas Cheer,
neededforsuchashow. Groucho Marx while performing his few feet through a protectively over- 134 Pfeiffer Street, San Francisco, CA
TonyandIquicklypeddledourbikes duties as circus ringmaster, horse sized flamingring. 94133.
uptheroadandaroundthebendtoour trainer, rideoperator, anda numberof Periodicallybetweenacts, Bunnythe
homes, telling everyonewithin an ear- other positions way too numerous to Clown,whoseonestrongattributewas Treecycling"
hot of the wonderful event coming to mentioninasingle breath. sounding exactly like Larry Harmon,
ourlittletown. I'mprettysurethatboth And what of the bottle-swigging, the original Bozo, ran into the ringac- Recycleyou holiday tree. Ifyou live
ofusexageratedthepicturesandevents suspender-hanging, put-the-pieces-of- companiedbysomeverystrangesound- inSanFrancisco, "treecycling"dayison
printed on that poster, but that didn't the-puzzle-together man in the middle ingclarinetmusic, andwouldbegin tell- the first recyclingday afterNew Year's
matter, becauseacircuswascomirfg. of the field? We would see him later ing a string ofvery simplistic, G-rated Day. Justput the treenexttoyourblue
During the next couple of days, I that day in full costume as Bunny the jokesinastylenottoofarremovedfrom recycling bin and it will be picked up
kept stoppingat the field everychance Clown, a character bearingsimilarities latter day Henny Youngmaa Bunny with your other recyclables. Call 554-
Igot,lookingforsomekindofevidence to Red Skelton's Freddie the was actually quite an accomplished 6193 ifyou miss the collection date or
of the pre-planning, but even on the Freeloader. Bunny was engaged to magician,asmanyofhiswellsequenced foralistingoftreethecollectiondateor
Friday afternoon before the first Bonnie, the lady at the concession tricks, which at times seemed to be foralistingoftree drop-offlocations.
DAILY LUNCH SPECIALS
Leland Locksmith
CATERING AVAILABLE
OPEN GAME DAYS
200 Leland Avenue
Hours:Mon. thru Fri, 7.00 a.m. to 4.00 p.m.
587-8403
Executive Cafe
SALES * SERVICE * REPAIRS
KEYS MADE WHILE YOU WAIT
150 EXECUTIVE PARK BLVD.
SAN FRANCISCO
AT SAN FRANCISCO EXECUTIVE PARK
Open Mon. thru Fri. 9 a.m. to 5 p.m.
Sat. 10 a.m. to 3 p.m. (415 - 468-0500)
Tuntex Properties, Inc., San Francisco
Ar>n|«rl,<Ik*VWtartalVtll»fOrapvTlnafurvUdkrplh«B«nPVanciamArt*Ommi««»l
ISSUE U GRAPISVINK YOUTH SUCTION JANUARY 1993
WES
ONCE UPON
WINTER AT
FESTIVAL
A
TIME...
The add-a-story contest
This is a new contest in the Totally
Cool Vine. Here is how to enter the
contest:
Helptofinishwritingthestoryabout
the Beautiful Princess that you see
below. The story below waswritten by
9 people...so far. Each person in turn
added a sentence to the story. It can
haveasmanysentencesinitasyouwant,
and be written by as many people as
want to help write it. Be sure that
everyone who helps write it puts their
namedownasa"co-author",sothatthey
all can get credit fortheirwork. When
youaredonewithyourstory, send it to
the Totally Cool Vine, c/o the
Grapevine, 50 Raymond Ave., San
Francisco, CA 94134. The winning
writers will have their story printed in
he March issue of the Totally Cool
i
Vine,andalltheco-authorswill receive
certificates ofpublication.
Hereishowvour storvwill start:
THE BEAUTIFUL
FAIR PRINCESS
Once upon a time, there lived a
beautiful, fair princess. She loved to
makefriendswithotherpeople,andshe
By The WonderfulAridFamous lived in a big castle. Her father, the
ThethemeforthisyearsWINTERFESTIVALatWES is"ATIME FOR Writers: Ming Lisa,Jesseina,Monique !"vjng.chosetopickapnncetomanyhis
GIVING." All the classes performed on stage forthis annual celebra- On December17, 1992weVisValley daughter. Many princes wanted to
tion. ElementarySchool, hada Winter Fes- marry the beautiful, fair princess. But
tival^Time forGiving. Manyclasses todoso,youhavetoprovethatyoulove
participated in this wonderful pro- her. One of the princes tried to prove
gram.There were many Christmas himselftoher, butshedid not love him.
carols,pla\s,dances,andreadingsper- She did not love an)' of them. She
formed. Room 16, 17,101, 104, 204, 207, wanted to pick her own pnnce. She
201, 202, 203, 205, and 207 did wanted them to love herforwho she is,
Christmas carols. Room 105, and 102 and notwhat she is. One day. a prince
did plays. Room 108 read Twas the took the princess away to a far away
Night before Christmas". And last but land. Then the prince took the
not lease , room 209did three raps. .-VII princess* hand and kissed her. The
theclassesdidawomderfuljob,thanks princess suddenly fell in love with the
totheteachers,Laura Ellis, dance stu- prince. They lived happily ever after,
dents, Mr. Chao, and the friends and until...
families who participated in this
wonderful performance"Winter Fes- Registration for Art Studio]
tival, a Time for giving 92".
Registration for youth, reen and
AUDITIONS FOR THE adult classes is now being held for the
SAN FRANCISCO CITY Sharon Art Studio at Children's
CHORUS Playgroundin Golden Gate Pmk.. Fees
wiil vary by classes, which will be held
The San Francisco CityChoruswill fromJanuary4throughMarch27. Pre-
hold auditions in late December and registration is required.
early January for the Spring 1993 Youtfcs S to 11 can create theirown
season. Thechorusisa groupofabout uniquejewelrydesignsusingavarietyof
w6i0tmhesnhaarneddwoinmteernesftroinmamlaltwailnkgsmoufsliifce matTereieanlss,12intcolu15diwnilglmweatnatltaonsdigcnopuppefro.r
experiences in a spirit of camaraderie. Drawing and Painting. Magical Myriad
The chorus has performed works by of Masks. Animated Workshop or
Jewelry,
Handel, Mozart, Monteverdi, de Vic-
Adults axe offered Leaded Glass,
toria, Ariel Ramirez, Palestrina, and
Mendelssohn. Drawing jnd Painting. Life Drawing,
Under the direction of Frederick V.atercolor, China PaintingorJewelry.
Goff, the group will perform Leonard theTSiiaenSFhraanrcoinscAortReSctruedaitoi,oanfaancidliPtyarokf
Bernstein's Chich Psalms. Aaron
Copeland's In the Beginning, and GDreepearntmDerinvte, biestwleoceanteKdinognanBdowKleinn-g
Choral Dances from Gloriana by Ben-
jamin Briaen in April. Renaissance nedyDrives, andcan be reachedat 755-
7006.
musicwill be performed in June.
voiAcenyaondnerewadhsomuhsaiscpclaenajsoainnt. Wsiengairneg ACall For Umpires
jj
especially interested inceasing our
tenorandbasssections. Rehearsalsare Ifyouare 16yearsofageorolderand
held on Wednesdays from 7:00 to 9:30 enjoy baseball andyoungsters, the San
p.m. beginning January 6 thru June in Francisco Youth Baseball League \8
the music room at Washington High looking for you. Umpires are needed
School[30thAve.atAnza]. for youth teams participating in the
Rehearsls are held in late Dec. and Spring League. Special umpire
Mrs.HENDLEVS3rdgradersperforming"AMARTIANCHRISTMAS.' Jan. Formore information and an ap- workshops will be held, so no ex-
pointment, please call [415] 563-S826. perience is necessary.
The San Francisco Youth Baseball
Thanks to the U.S. Marine Corps Reserve and P. G. 4 E MRS LReecargeuaetiisonspaonndsPoarrekd. bFyLSAaMnEF,raanncdistcheo
CLAUS
(a long-time resident of Vis Valley - Mrs. Lois Castillo) and her Police Activities League. Additional
reindeer brought toys to all the children of WES. informationcanbeobtainedfromJohn
i -Peterat 753-7029, orRogerBrossat
566-9600.
B JANUARY 1993
Proper Fanily Nutrition a Key for Health During Winter Months
STORE FOODS SAFELY
kMeeaetp,fpoooudltsrmy,tfihsehraenfrdigreerlaattoerd(laetft3o4v°er-s3s7h°oFu)ldnobelorneglenrgetrhaatnedthoernfruomzbeenrFoofrdbaeyttsersufglagveosrtaenddbsealfoetwy us,Wtihtehimtphoerctoalndcewionfteprrompoenrtnhustruitpioonn wbietbhelotwheacenrutamibnelervelowfhipcehofpllucetuapteers
Refrigerator: Freezer - no more than anda balanced dietisessential forcon- household; incomefora familyoffour,
tinued good health in our families. forexampleshould total below$15.125.
• Fresh fish 1-2days 6 months Smart meal planning could mistakenly EFNEPhasassisted more than 450.000
• Chicken 2-3 days 12 months
• Pork 3-4 days 6 months be labeled a low priority by many ofus t'.imilies since its inception in 1969. with
• Beef 3-5 days 12 months in these difficult economic times, but 'anaverageofabout 20,000new families
• Cooked beans 4-5 days 4 months there is help available for people need- expected to be reached eachyear.
• Gravyanddressings 4-5days 4 months ing assistance in choosing the right Paraprofessionals, as employees of
•• ECgogosked meats 42--53dwaeyesks 3 months foodsfortheir families. UC'sCooperativeExtension,arehired,
Administered in California by the trained and supervised by home
STRETCH YOUR MEAT DOLLAR
University of California Cooperative economists to provide instruction for
Smallamountsofmeat, poultryor fishcangoa longwayifyoupreparethemwithother Extension, the Expanded Food and small groups. Thosewho complete the
foods like Nutrition Education Program program are able to use their EFNEP
• Meatloaf, meatballs with breadcrumbs,oatmeal, (EFNEP) provides low-income knowledge and skills to provide more
rawgrated potato families, especially those with young economicandnutritiousfoodsfortheir
• Ground meat, poultrywith macaronior anyother children,witha basicFive-pointconcept families.
pasta in educating homemakers to improve Evaluations of participants' diets
• Rice withchicken, meat, eggs theirloved onesdiets by understanding show significant and continued im-
nutrition, shoppingwisely, and prepar- provementsintheireatinghabits, espe-
• Liverorotherorgan meatswith vegetables ing and preserving food safely while cially in the consumption of dairy
orotherfoods
learning about good nutrition and products, fruitsandvegetables.
VEGETARIAN MEALS CAN BE NUTRITIOUS health practices. More information about EFNEP
Tnehee)parroetehiinghofqubaelaintsy,prrioctee,icnowrnh,enwheeaatte,nbrIneacdo,mbtoirntialtlaiso,nasnldikfelourfromcereals(wheat,corn,oats, in EMoFsNtEcPurrreeqnutirgeuidthealtinfeasmfiolryeilnnbciolimtey c1a-n510b-e64o2b-t6a4i4n1edorit1-51b0v-9c8a7l-li0n1g43e.ither
• Beanswith riceortortillas FOODS THAT CONTRIBUTE TO PREVENT ANEMIA
• Ricewitheggs Irondeliciencyanemiaisverycommon,especiallyamongchildren,leenagers.andadultwomen Foods
richmironhelptopreventirondeficiencyanemia Organmeals, meal,beans,lentils,eggsandotherfoods
• Peanut butterand bread are richmiron Seebelowtheamountofironinonenutritionalserving
• Pasta andcheese Iron infoodsisbetter utilizedinourbodieswhenfoods rich in IronareconsumedwilhvilaminCrich
COOKING SUGGESTIONS foroovdesgestuacbhleassaodldreudsflrouidtsi,shceasntwaelouepate.,cbarnocciomlpir,ocvaeuliirfolnowienr,ougrredieent.pepperandcabbage A fruit, a salad
• Trim visiblefat frommeatbeforecooking iron supplementsshould nol betakenunlessrecommended byaphysicianor registered
• Do not overcook meat, poultryor fish Overcookingdecreasesthenumberofservings, tdaikeennnan Ifironsupplementsare prescribed, onlytherecommended amount should be
toughensthe meatand reducesjuiciness
• Cookbeansproperlyandaddenoughliquid Undercookingorusinginsufficientcooking Excessiveconsumptionof ironsupplementscandecreasetheutilization ofother nutrients inour
liquidgivesunsatisfactoryflavor bodies
• Skim oft fatfrom meatjuices,or blot liquidfatfrom meat with papertowels. How Much Iron is Recommended perDay' Uver (pork. beef, chicken). 302 Iron9m5g
Age, years Male, mg Female, mg KHieadrntey(p(oprokr.k,bebeefe,l.chcihcikcekne)n,),3302oz 6731
••UsuBLaeelaslnsysl,LeencshdsiecrEkxceupnle,sntsouilrvkmeeeya,tesggasndgrouSnMdARTSHOP••UsPuBTIaeelNenllGd.yevMreoalrc.uellsaEmxbap.nendpsorihkvi,egahenrdlgurnacdheseonofmemaetasl P1IIrI9etogtoorn1am01n8otraendlactatingw111o002men 31110550 CSCCCoooooyoooobkkkkeeeeeaddddnrplsceieonundytrtibdolbes.e.aban8en1saso,nc,zsu,1p1cc1uucppup 5444633925
meat (lom, T-boneandporterhousesteak) Squashseeds, 1 oz 42
• Liverandotherorganmeats • Regularcutsolmeat Cooperative Extension Tuna fishand sardines, 3oz 26
•• PGirnattoedantdunmaostbeanssoldmbulk •• CBehaunnskatnudnalentilssoldmsmallpackages DUiNvIisViEoRnSoIfTAYgrOiFcuCltAuLreIFaOndRNNIaAtural Resources GDBerreyofu,pnefdaatsbfecreeofe.o,k33edoo.zz1 cup 222444
• Homepreparedmeat, chicken, hsh • (Psemadoyk-etdoaenatdbmeaartb,eqcuheicdk)en, hsh E»p«n<J«JFood»rxjNutritionEduc'.or.Program HEgogts,dog2s. 2 (2ozeach) ?204
• Storebrandandgeneric loods • Nationalbrandloods PPoeualntruyt,bfuattlefrr,ee,43taobzlespoons 11 02
LEN'S SOMEWHAT CHALLENGING MAZE
WOODROW
WILSON
BASEBALL SEEKS PAST
PLAYERS, COACHES
The Woodrow Wilson high School
BaseballProgramisplanninganalumni
game and return and reunion, in addi-
tion to several other events, to help
celebrate thirty seasons of varsity
baseballcompetition on thepartofthe
Warriors.
All former baseball players and
coaches are welcomed to contact the
current varsity baseball coach, Dan
Harrington,formoreinformation. Call
469-4550duringschool hours, orwrite
WWHS
Baseball. 400 Mansell Street,
San FranciscoCa. 94134-1898.
VISITACION VALLEY
TOTALLYCOOL
VINE u
YouthSupfllKBMl
Conchit* Bnpflfa HoiMuDm
MJaeraidnoaaHAgdoama AahleyMartin
Lit* 3aalaa TUltaHoward
Mix*Saala* CarrieHoward
BufeneLaoejr Ji
Moniqua Sartdoval
Advw*.; Victoria
•>uli» Km,
rxcjdd Mr.Lae-y
JANUARY 1993 C
New Directions Program Designs New Ways to Reach More Families
FOR A HEALTHY MOTHER AND BABY
California's Expanded Food and food safety and sanitation, and use of Follow these recommendations
Nutrition Education Program has im- commodities. ...
plemented an innovative spin-off en- EFNEP is 3lso expanding its
ttihtrleedem"aNjeowrDpirroegcrtaiomndse"liwvheircyhmeptuhrosduse.s acbyuodmtirmaeuinnnciientgybtyhaegiecrnoscotiraedfsfisnaaantndidnovgroglwauinntithzeaeotrtisohnetsor bEatraetlaekaafnsatsattd;herqteuoeoamtmeeaaanlmsyophueonrutrdsaanywditDvhoaonru'itettfysokooifdpfcoaonds Eat
Throughproviderandclientsurveys, deliver the program's nutrition educa- affect your unborn baby.
EFNEP's Food Access Program helps tioninformation.
sciosmtmauncneitnieeesdasssaenssdedmeevregleonpcsypfloaondsast-o proSbplaenmisshrelraateddiototfaopoedscofnocsuusmipntgioon,n Gduaneidvneeirlnwogepimegenhnottubgoehffoywroeeuirgphrbteagbinsy.aInmIcfpyoy,rotuyaonwuterfoer the
address hunger at the local level. shopping skills, diet improvement, and areadvised to gain between 28 and 40 lbs If you
EFNEP also assists providers and money savings have ben developed by started pregnancy with adequate weight, you
clientsofemergency food systemswith EFNEP 's Media Development Pro- sDohno'utldtrgyationlboestewweeeingh2t5daunrdin3g0plrbesgnoranmcoyr.e.
nutrition education and technical sup- gram,whichhasalsoperoducedaseries
port. Nutrition education topics in- ofthreeto five minutevideotapes each Visit a doctor within the first weeks of
clude: food budgeting, meal planning, targetinga single nutrition topic. pregnancy. Diabetes, hypertension and
other health conditions can be discovered and
treated before they affect your pregnancy.
Better Nutrition Starts With Better Meal Planning
tipsEfForNEbePtterrefcaommilmyennudtsrittihoen:following ltehses.pAriHcefopoedrssheoruvlidngbeinpumirncdh.asAedbwointyh pkIfrnoyotoweucteaaryreloyuurssiobnagtbhyme.esdeiccaatniobnes,chleatnygoeudrifdonceteodred to
Besuretoplanyourmorningmeals. meat cut, for example, may be low in
Bbreelaikmfiatesdttdooberseankoftasntecfeososdasr.ilAy hpaevresotno pinngcsetphearnpaonuontdh,erbucuttwiolflmyieealtd.*leBssnserv- mAevdoiicdataisopnisri,nlaaxnadtiovtehseranpdaionthreerlioevveerrs-,thsel-eceopuinntgerpilmles,diccoaltdions, falsi Vl_***
caneatjustaboutanythingnutntous. Differentformsofthesamefoodcan
thaFnonoedesdepdreatpaarpeadrtiincullaarrgmeeralqusahnotuiltdy bPreicceosmpoafretdh,e assamweellfoaosdthmeairysvizaersy. «gArvoowitdhdarnindkiinngtelallicgoehnocleicofbeuvnebroargnesb.abAilecso.hol can Impair the
be immediately refrigirated for future depending upon how it is sold: fresh,
consumption. Leftovers noteaten at a frozenorcanned. Freshproduceprices
previous meal should be used within a varywiththeseasons, butsomecanned nAovromiadlogrrloiwmtithcaingadrehtetaeltshmoofkiunngb,orans ibtacbainesdecrease the
day for safety and best flavor. If your and frozen vegetables may be lower in
family enjoys snacks, select foods that pnce than fresh vegetables out of
willcompleteyourdailyfoodneeds. For season. Andalthoughthelargestsizeof tuIfseyotuheemnjionymcoodfefreaetioront.ea. Including herbal tea,
example, if your meals o not have a grocery item is usually the best buy.
ethneonugihn fsrnuaictskso.rdaGioryopdroidduecatss,iinncclluudde:e yproiuce,syhoouurldstoarlasgoedceaptaecrimtyi,neandit'isfyuonuirt rIfecviotmammeinnsdeadn.dTmoinoermaulcsharoefpsroemscerivbietda,mitnaskeanodnlmyitnheeraalmsocuanntdecrease
milk, yogurt, cheese, fruits,vegetables, familycan useitinareasonableamount the nutritional effect of other nutrients.
hard eggs and leftover meats.Smart oftime.
Food Shopping Means Better Family Understand the difference between HOW WILL YOU FEED YOUR BABY ?
Meals.Altbough sometimes a cumber- generic, house,and name brandswhen
sometaskrequiringwillpowerfrom the shopping for your family. Generic
gimmickrystoresandsupermarketsim- (plain label) foods are usually the least Breast milk has everything your baby needs for growth.
pose on their customers, smart food expensive of all, and have a nutritive Breast milk helps prevent yourbaby from getting sick.
shoppingcan be made a more pleasant valuesimilartoexpensivebrands. Store
undertaking when planned properly, or house brands, the store's own label, Formula Is another wayto feed your baby, but
according to several guidlines sug- are usually priced lower than national breast milk is the best food for babies
•MS*
gested by UC's Cooperative Extenion or name brands, whose quality may be Breastfeeding can help you to losetheextra weight you gained during pregnancy
EFNEP program. Before going to the touted as better, but have no better
store, planyour meals for several days nutritive value than either generic or There Is no formula to prepare no bottles to sterilize. Breastfeeding saves you money.
in advance, checking to see ifyou al- housebrands. START SUCCESSFULLY
readyhavesome oftheitemsyou need Ifyour schedule allows ample time,
tobuy,andwritetb*enecessitiesonalist getintothehabitofreadingfood labels, Start breastfeeding soon after birth and breastfeed
rememberingtoincludesuchstaplesas printedonpackagingforyourinforma- often to stimulate milk production. Avoid bottles of
spices, dry beans, flour, rice, corn tion and protection. Check each item water or formula for as long as possible. Bottles of
starch, vegetable oil, pasta, sugar and fop package weight, expiration dates, fthoerymudleacorreawsaetefrrecqaunendceycroefassueckyionugr.mIinlkadpdriotidounc,timoonstas
salLProviing you have access to good andprouctingredients. Read thepack- babies become confused sucking from two types of nipples.
transportation, a market can be age weight, taking into consideration
selected with regards to convenience that some large boxes maycontain the • Position yourself correctly, holding your
andsavings. Betterprices are available same or less food than smaller ones. Ybaobuy'nseemdoustevherIanlfrpoinltloowfsyfoourrbneitptpelre.support
at discount food outlets and national Make sure the "sell by"and "bestwhen of yourself and the baby.
chainsthanatsmallconveniencestores. purchased by"datesgiven on each item
Fbeorpautlrtoinmiazteedstaovicnogsm,psaerveeruanlitstporriecsescoann aafltleorwiytsopuuracmhpalsee.time to keep the food hcTleiocsokepleetnotshyeohuib,sabmmyao'kusitlnhogwwesirduerH.ephQweuitithcakkyleoysurpauslnlimptuphlceehbuanotbfiyl n
the foods you purchase most often. Consumers,bothnormalandfollow- the brown area of the breast as possible.
Generic (plain) labels often have ade- ing speciasl diets low in sodium, sugar
quate quality, and can provide a sub- orcholesterolshouldcheckproductin- *oSnuctkhienngipopnlet,hIesbnreocwenssaarreyafoofrtmhielkbrperaosdtu,ctniootn].usTthe
stantial savings over the brand name gredients listed in order from the most baby's Hps should makepressure on the milk channels
items.Whenshoppingupanddownthe to least amount found. Check the underthe dark area of the breast.
aislesofa supermarket, bewaryofspe- names of preservatives or other addi-
cials. Although markdowns and tivesusedtokeep thesafetyand quality iWnotrhkeinregfrmiogetrhaetrosr ocranfrbeerzeears.tfeed. Milk can be pumped or expressed by hand and stored
coupon savings products will save you ofthefood.
money,tbeymayalso buyproductsyou •If you choose formula, prepare It correctly. Too much ortoo little water can be harmful
to your baby. Follow manufacturer's directions. Cleanliness Is essential. Hands and
don'tneed,can'tstore,orarestillhighly You should never go shopping for utensils needed for formula preparation should be washed thoroughly in hot soapy water.
priced in comparison to suitable alter- foodanywherewhilehungry. Notelling
natives. Alwayspurchaseproductswith wbatyou'llwalkoutofthestorewithon TVauthoruF.nnRoriKro-G*yn<ir*hD CommunityNutritionSptrulul.UnntnilyofCjlt'omu.•...,*.....< fincntKMi Anui.Piul.ncVu
unit pricing and price per serving in an empty stomach. Have yourself a
mind. Using the unit price helps you healthymealorsnackbeforehand, and USE SUGARS MODERATION
'ecide the size of product that costs then shopwithconfidence. IN
Sugars Includetable sugar, brown sugar,rawsugar, sucrose, glucose, maltose,
honey, syrup,corn sweetener, corn syrupand molasses. Afoodcan behigh in
Fried foods and pastries are high in fat sugar Ifoneofthese sugarsappearsfirst orsecond on theingredients list onthe
label,or ifthe label showsseveralofthem.
Too much tat of any kind, Including solid, soft and liquid fat, can form fat In our
bodies and Increase our body weight. Too much fat can contribute to overweight Sugarsareadded to foodsto makethemsweet,to preservethemorto make some
and obesity foodstenderand moist. Sugars are In manyfoods, no!justsweetfoods.
Overweight and obesity Increase the risk of heart disease, diabetes, high blood
pressure and other health conditions. Sugars provide calories but are limited In nutrients. People who want to avoid
gaining too much weight will benefit from eating less sugars and sugar-rich
Too much fat, especially saturated fat and cholesterol, can Increase blood foods.
cholesterol In most people. It Is important to have the blood cholesterol checked
by a health provider. Cholesterol values above 200 Increases the risk of heart Sugars can contribute to tooth decay. The more often sugar-richfoods are eaten
disease. and the longer they stay In the mouth before teeth are brushed, the greater the
risk of tooth decay.
Choosing low-fat foods is recommended for most people, especially persons
who need to limit calories and persons at risk of heart disease. Limiting tats is Sugars in Selected Foods
not recommended for children under two years of age.
Teaspoons of Sugar (tsp)
Pastries and bread: Breakfast Cereals:
tsp tsp
HOW MUCH SHOULD WE EAT DAILY? Chocolate cake, Iced 4oz 10 SugarSmacks, 1 oz 4
Angel food cake, 4oz 7 AppleJacks, 1 oz 4
CTPHERIEELNGDSNRAAENNNTDAANDDULNTUSRSINGMOTHERS . 223ssseeerrrvvviiinnngggsss(((122---233ooozzz eeeaaaccchhh))) CDCoohnfoufcteo,elagctalekaezc,eadk4e1,ozplain 4 oz 666 CFSrhroreseatdmeddeorfdicwwehh,eeaa1tto,,z11oozz 310
Pie, 4oz ' 5 Oats. 1 oz 0
Toast, plain 0
D JANUARY 1993
49 £6
JO
Cathy Kline
—
/??3 Sts/sM* — 21
I 10
yJg&MACy 28 A/jy — 27 lb
fc&&Ai*Y — 25 — 24 Marketing
ICOMKCHOMUNfflcouicicri*»1MCICO Senior
AtA*c* 25 jZ*y 21
£
Consultant
ill >^
a* Born and raised in Visitacion Valley
-r/f -tfrva
— -/7UJ HAPPY
-b*8 NEW YEAR
Dental Office
Visitacion Valley
brokerage
Albert Kuan, DJ>.S. residential
services
Grubb&EIlis
10% Senior Discount
2633 Ocean Avenue
37 Leland Ave., San Francisco, Ca. 94134 San Francisco, CA 94132
ton. • Pri. 9.-00 to 5:M Stturfty 9*0 U bOO
Phone 239-5500 for appointment (415) 334-1880
CnntonsiD ipoten
WCC
BINGO
RAYMOND AVE
66
Bayshore)
(at
SAN FRANCISCO
or
5535
Uu^Cfr^ SUNDAY AFTERNOONS AT
1:00
P.l\
DOORS OPEN AT
<? 1 1 :30 A. M.
$63 00
*
1 0.
PA YOUTS EACH GAME
GUARANTEED!
2 PAD MINIMUM PER PAD)
- ($5
a w
.. .. . .
JANUARY
1993 g
SAN FRANCISCO UNIFIED SCHOOL DISTRICT EDUCATIONAL PLACEMENT CENTER
135 VAN NESS AVENUE - ROOM SAN FRANCISCO, CA 94102 (415) 241-6085
1
Dear Parent/Legal Guardian: Estimadopadredcfamdiaorutoq
W1e993-w9o4uidPrea-pRpergeicsitartaetiyoonu/rOpttaikoinnagltEinmeroltlomernet*lRetqhueesftoll(oOwEiR)ngPrioncfeosrsm.ation regarding the uAccuodnUin(uOa.cEi.oRn.)c.nccoonrtrrcasrpaonidniiconrimcacaildcnicvlaolieosscaolaacrcr1c9a93d-c9l4a.matrtculacscoIotydelproccsoparasolicituncambiodc
ACE R.EQUKFIiiRnrEdsetMrEgNGaTrrSatd:een:: HHuusstt hhaavvee bbeeeenn bboorrnn oonn oorr bbeeffoorree DDEECCEEMMBBEERR 21., I1S9»8B87 REO••lPPfiarlraaSkpairTnidOmeSerr,RglrFoas.dIcos..tAuITdoIjiaVcnOsi.tcuSsdidAaenbteLcnsAddeeFbh.eaDntAedDrc:MhCailxdrondac2idUoccdli2cidccmbdrlccidccmb1r?c88dcP.1a9n8u7soantes.
REQIflSHflS A LA HORA DE ENTREGAR LA SOLlCtTUD
REQUIREMENTS AT THE TIME OF SUBMISSION OF THE APPLICATION •Pruebadesudomicilio.lacualdebedcscrunadclassiguicnics 1)LalicenciaparaconducirauiomOvdcsocl
. aDaoVTdetdeedphdlrraereierrepfstshismsocgeenaondetvtiemrounsnBttmiooelfnlot;tfbhaee«l:otpch(aoea4r)rg(eeh1nn}oHVctmeey/edDh.lirie-ciagClvdaaeedllsrrI;'efssSgstutiaLh(crioe2,kfdceieDranrCtnsuiherveorefferprona'rottrsmheeIn.PLttD.pih./Oaec.releen6DgnsecatepaEl/ar.lrdoetrggmubiaeiasIlnlr.stlDdu;.ieadgonfucaa(rbr-3Sdydo,icTaihChnaeuat;lsrhrPeerSbnoee(toerC5f)nvailcioPcfef-LhsoCearithnno/tgimleeoaeCrdr nccLPaaaurcmrzuieumelyidbciGdnaraclisgoIdi.de(dca2Pnl)uaaCfCuicfsc&retauccchfdEiaiOpc)nodarecd3lmop)iandiUneianledcoiHdrmeoeplicsoicprDbniccoullpJoaDaccntd3upea)alamlAneecdanstcmilaeouladdndcliccaooBnSmatdceucpr.uavTsinlrc/maaiaonoc.sdsucan4Slo)otccdpTilacuadrelfCjdcoacesnlLoiaosfsodcd(rrecPnlaiuocaMnti.carfdaii2dcd)-ccBCUpeallncallsn.)rd.seci4cng)icubiTioaacrnagjclctucutsbaaelIdm)deaclAmclMcatcnacduiolo-m.CppaaalAr.lua5d)adcUdnca
within the past ninety (90) days, a second verification will be required. Siporalgunmoilvonopuedeprcscniarlosdocumcniosmcncionadosanicnormcnic.porfavorvengaanucstras
Pcreorotfifiofcatbeir,thordaHteedi-iCnalthestifcokremr.of a birth certificate, hospital record, baptismal oonfbcilccicigsnaaacsni.oo.nNcosswqrueostosdaobselmoosscsqtuuedihaanytcfsamlielnigaasniancdcoccsuomacnliaacddauscaociqdunecpaurbclciccan.dpeorunloholagnalro.pIccramyaundcnairecmoNsucesnirloaquesea
APPLICATION PERIODS Begins Ends Notification to Parents rERfODOS PR SOLICITUD Emulua. Hmliia. Fcr.ru dr. Nnlirkatiftn.
FSTiehrcisortnddPPeePrreiirooiddod 11i1///113/809//39932 316///311155///999333 WWyeeeeeekkk ooofff 357///831//899/3393 23lroedr.pppeeerrriiiooodddooo 31I80dcddccabenrnoiclvr.docddc1e91919399923 311155dddcccjemunacnrrizooodddccc111999999333 SSScccmmmaaarnruaudddeeelll83l8dddcccmmjaaurylziooodddccc111999999333
GENERAL INFORMATION Apclacion 20dcjuliodc 1993 6dcagosiodc 1993 Scmanadel20dcagosiodc 1993
Applications will be available at all school sites. 135 Van Ness Avenue lobby, INFORMATION CiF.NF.RAl.:
and the Educational Placement Center. They may be submitted at any school site
or the Educational Placement Center - 135 Van Ness Ave.. Room 1. •Lissolicitudescstandisponiblcscnlascscuclaspublicas.cnclvesifbulodclasofiarusccnlralcsdelDistnioEscolar
PbacAb1arsopa2se)sipli-inrasrgcon,enivcimgdaefeielnssttnwotroifwhartiethlailcstocwhttnioebhulreedlderiaOnmenpstaqgts'dpuiisereogestnn-toweamrehnleeedrtnngohtilEessslnc(tmrhh1ero)oowonalimltltletlmih(eoeawsnn)ridntledoltraeCcgisoscubnsmeooa.tprrsumdaptainaaedntcdregeeAvesesroRmtnisaoegnplnldtgymaoahucemeiendimtefPrmeslirpeniraoqtcsncwutteieel-ssslcstaotetsmdbaeheeten,dgtrrhfaeaortdfnraieidctmihroesalscmllhiiteonvz-/ioeeesnellsdet.rhvnateinothdcdfoe cdccc•a•scndLLcmcpuaoulucpcsscaicnarclsOadidaoaficloldivnupicoacaumclsiibinqnaltpcouasuirnsed.co#ealc1nIusaccoobdsssipeocesocclbrcnand'ardDceccnaailcnntssopcDuemicadccloaerncprpcuigaadccnmralneiaodeaOniaannmuluscineamupocdnceocuoirrrdaasdooenmaocdzbdE1aooiacvr3:noas5EfaludvoduIeiamd)carloiccahumlcsivaiaacedcytausanilicvcldloyoeiseanronp.Md.iacEaecdsotAnicamroopiclVmucadnanutrilnag.qsadpuuNooenEenrssiasccsbesso.l.tlpcuarcdLrecoia-nia(slnnEncicdlssciucogdcrlsriaiicactebiaidIntcnodou.nogdcaalecolrasroaPprnnpcrltusccaiclp-zcdoiaesenirnmdnstseiicncqcsntmucnprieacCecieisdnoncettnryreleare2zs)ig)acr,avrosdcsilaycsasnnrutfoscoesnhccdehaochnayusascarullltniqpludleuiacfmnceixrccsul
Federal Court-Ordered Consent Decree. adversocnclbalancectnico/racialdelacscuclaquecnvlaorccibcalcstudianic.conformcaloquelasnormas
SsichboloilngANDpriloirviitnyg iats gtihveensawmheenaddorneesschiwlhdenisthealraepapdlyicaetniroonlleids astubmtihtetedr.equested cd•sSeucbbeIlcncdcdceanp.vinvoinrdcandelalmlhsermmoadnoomidcciluino.cstudianicquevacstaasisucndoalacscuclaquescsolicna. Amboshcrmanos
Uthheen chailcdhilwdilliscoenntrionluleedatmtenadiSnFgU,SD cphriilodrrietny'swilclentbeergiavndenthteo paarfeenetderindisccahtooels t•\Couacnlldaoccolncusntuuadriainaiscicssltiacnidnoscariltaomcinsmuan.asgcualreddcarritadpenlonDidsatrdiiaolEasccsocluacrlaUmqfuiecIacdcoordrccSsapnonFdreanacdilsccho,agyuuasrtdccdriian.daisc!aque
fnootr btehegicvheinldrteon'fseedceerntesrchoaonld atsrsaingsnpmoernttastiownhenwiltlhebeOERpropvoirdteido.n (SPercitoiornityIII)wilils mpairsamoso.lisccitlaerpurnovccaemrbtidocdtcracnsscpuoclnae(esscccoclairo.nINIIj)j.scIcdartpnondadaulcscucla.sisc(Jenalapartecorrcspondicnic
cPaormepnltest/eldegal guardians may request up to four (4) schools in Section III m e•sScappruocbdaednasuolniacidtcarlhaassclsaccuucaliarsoqcusecuhcalacss.coDgicdboc.nndoctpecnddriirlscdcsroclcahmocnalcapcalqaurc.llasquecstiustcddispucstoaaccptar Si
the OER portion. They should only request schools they are willing to accept, •NucslroDistntoEscolarlicnclarcsponsabilidaddccolocaratodosloscsiudiantcs Cuandonoscpuedeaprobaruna
when an approval is made for any of the four choices, an appeal will not be dclascscuclasqueustcdsclccclond.elDistriioiraurldcdeslgnaralcstudianicalplanicleducatlvoquelecorrcsponde
accepted dcacucrdoasudomicilio. Dichadesignationschartdespucsdelperiodocnelquelasolicitudfuccnircgada. Sila
AJgupulpayeradlisa2n0,swiwli1ll9l93.bbee asDecnceteapdtnleodmtiefoTinbclryatiaaofcntceerplteattnthceeerstihsniordAulgcauotsemtrput6t,ehranr1aA9n9u3dgousmatndp20r.opcaer1se9sn93ti./nlgegaoln du•ebCsiuciaagnrndaaotlicroscntcuindboiaaflnuaicccaucrnntaaudcnenolldaacsqculseocsuscccelnIactsrdeqcsuseicgscrcsuoclolagariccOss,cqupucueleaduseatscaudcchspletjlaoe,rcdtlaeiobdnce^rs.aigdncacciodmnplyctnaorsoytrdocsvoclovnctrinlauapracnmeosdciraabiaajnododcdcli
. TsDahcidehsdotroerlsiSsca.tnplacFmeraTmayhenenctiassacsfsoiosgrinUgnanilmtlfehineetcdhsitlSuwdcdirheleolnnot.lbetDoimsUatthdhreeeincsatacfnhtoheoaOrlsERtaohfcehroaecissocspmeiopgnunstcmiaeenbrnnitoltirtfayobnredotomahpipsr/ppohrrveooervcdie,dseshiotnmhgeae acdicaon-rcduurmmtaeiqnnuutxecastohliaraoconegrDqlcusopeadnso;eauiamrenosneedicesoa.bJrosia?sail.caimeniscstoomo'l5.i)liui.cm'nozd.slrcrtaniqaneuljeegcsxiaresoajobidjncaslaeqqnuf^beeisreflaasJeSsem]ircuondaioxarcnatfae.jslnascekca2hscnj.uu£aceilpvaa.o-jc.eoZnrVrnZcsuLpeosn1sd1oi.e"Dn-it0sct.".£Ui?cjv.'alLn-o'd.ToB.'tl-todraidI:
poweferiwohidlils/inhceorwnhtiiccnhhouiectehtseo,atprpytlhietcoatpmiaaorkneentwpal/salcegesamulebnmtgiutatfreoddri.aonneImfaoyftahtechceeapsOtEsRigtnchmahetonitcaesssw.aisgnmneontt oanned cDsucruacnltaehcalypacrsfidoodoapdrcopbraed-ainsLcraiptcarijdcniausdtccdlansovanccucrcussiudepbrcescinndiiacralracclonmsctsancyldaiadcenvaqcuuerulsa.sdEdssius sfcueprrocnscandtmairntisciuraanddaos.It
. cUttophhneoetnpiorsrstemtucamdetaeiinrpotktn ooinffsliahtnpehe/sathoslesetittgihenserm.pEnndetuwcIaFltteoitTotHtneEhareS,lEDiPStshlTetaEcrPeipSmcaetrAneRtnEwti/tCNhOelTienqntaeFlrOfiLvLAgeNOuDWaErwDdoAirLakSnOiTnHgMEfUuSlA(TlP5)yPRrOeVtrdAuaeLrygnsisMIttLeohLfre Lcdneaoosmsdcovepbatlccairucaprmrudbuserecebtxaedincdgeicr1dlm9aas9i3ts)usbodcncrT:cauumnplbolairlnulc.oonm.ldiacclqlohnusaieebss.cntrotusrdcdiipealrbnectea(clddsiiczfaldtdccoeri.nkaei.rntmdoeisrsfycdrcpirruiunmyearcfligotracatdlaaonohd)oe.rbascarqrtuanemdpccilOctnsetn(uerdruibcadnloiclcax)ianmygcrpncaspcfclrasaiclsoa..ccsAlcsuclculaal(:
BE CANCELLED AND THE CHILD WlTZ HAVE NdTfTTlTTEHETTT TO THE SpAClTLATER UstcdpuederccuTicarlaidcniincaci6nCtnica/raciaJdcsuhijounavcz.micnlrasest!iascritocnlascscuclaspiiblicas.
. Wchuernrenttheimmupnairzenatt/iloengarlecorgdusardtioanincrleugdiestearsneghaitsi/vheerT.Bc.hiltde,st hwiet/hsihne onweillyearneeodf Sinisncerimpbtairognop,arcasidciccahmobai/olotendricfectocuandocomicnccclanoescolar siguicnte(1993-94)yqqduranteclpcrfododc
school enrollment (September 8, 1993). kindergarten and first grade students
mult il«o have a complete physical examination within a year. AprcciamossumicrcscnlascscuclaspublicasdcSanFranciscoydescamosquesuhijolengaunanoescolarUcnodccaiio'
A parent/legal guardian may correct his/her child's racial/ethnic
. identification one time while the student is enrolled in a public school.
However, changes will be made for the following school year and not during an h m m m £ « b
open enrollment period.
We wish your child every success for the coming school year.
1992^ 11 380
*S' CH A
H*t\a\ n« H«9u1«ngA1g«l,nt Ttgtpig.altgc /fc IB :
Anlng lkalulu9od kung bibtssMn ntnyong mtbutl ang siwusunod n* Impormasyon tungkol s« 1993-94 w at*n14m»amawt^w 1993^ 1 199<^ bjjt aie a m k*ft srr-
Piunang Pigptpal1sta/Para»«r«ing Pagpasok ia lb* II tUkitlkcUng Paaralan (OER).
HOA OAPAT KA EQA.OK:indergarten: Iptnanganik ning o b«90 mag Ika-Z ng OlsyemOre. I9B8. •• V~)f<ift4I8B :; d£'*5'f*lj5hti 11998878J*>^i I122ffll 22aa aa22.W(TO HIfIJ ±£fVt) .
. Unang Grado: Iplnangmik nang o bago nag og Olsyewbre. 1987
HGA KAILAXGAH SA 0H»S NAWG PACSUSULIT HG APUKASYQH:
. K01agE1.p.a;p0.a(t3u)knaar'ydMednbiguchadalttresSkatstlKcrakogenarwsna'grnagnUmranagghualSanansgan/kg1yaa1angggau1lnaannyag/Htlaalkggiaanplaag-nnaagItCaaaglagia;fpoalrgln-hiaaala;agnag(-2()Kla)kgaalswllasurtkanunsylanyngagnsgraaesPlPabagogmHanmgUannPge.-hG.o i*fwB.uTR'<2>t^itfiiwcatioArmjnftwsiiA ij--i t&twiiot'ja«iwaxf«t:* .tn<i>ijom k « «^faAacianiA»W«ft»a/nsaBs
kod Pangllpunan o Ibang ahenslyi ng paaahalaan sa aiguUng/l1ga1 na tagapag-alaga. Kung ang llstnslya
skaatplabagymaanm.antho o I. 0. kard ay plnalltan sa loob ng nakallpas na (90) araw. kallangan ang pangalaoang i£<wui^aMfE*»seai^iifi. yra# n btnjuaaftmviiriSTjtiiia.
.
. Higpapituniy ng Petsa ng Kapanganakan tulad ng sertlplko. ulat ng ospltal, blnyag. o 'Medical Sticker*.
MGA PANAHQH WG PAG-AAPtAT SIMULA KATAPUSAM SULAT SA HGA MAGULAWG Wife JLiL
Uilnkkaaatnlgal«oaPnngagnaPhPaoannnaahhoonn 001411///013108///999233 000136///13151S///999233 LLLllInnnggggggooo nnnggg O00S37///001388///999333 11999923 If nIffll 31e8B 11999933 i^f I3f^l 3I1SBB 11999933 t*f. Sfl 83BB a«mW
HA.8UM0aAkNaGkakIuMhPiQRnMgASnYgOaH apltkasyon sa lahat ng aga paaralan. sa bulxagan ng 13S Van Ness A»enue o sa Sentrong 1993 If 4fl 1a 1993 *F 671 1SB 1993 ^ 771 IBB 0\*l
MagsusuM ng Paglalagyan sa Pag-aaral (E.P.C.J-135 Vin Hess Avenue. SII1d »1.
. HknniuggnhdaOpiEaRaannragaslagtaaanpgkaadna-aaylnnngdgaapalganlagaaarnlakgnluannsngaannggta1ygnouponnalsaasunanmgadlnalagurnepsakaasnlaskhyaoooannpp.aynunlgtaeurUlrananahgnagnpkaasgaspaapbpaaauylnlasnntggappaaatngapMoaanprdaa1lalnsgrtlanp.aasaAuknnagaklaaatglaoyapakalgatnaastiaaxkaedkru*t-e *ROOIIM*1.5«jfrfaji*fiMiff«tSti*S5t]*IKf3lZlaIfWn-sM^vIant*ne«s»s*a4veAn«uejl|i»i8,ft13fsj£vaAn*ne*sRs*ave.
. Ang aga pagtanggap sa hlnlhlMng na paaralan ay gagialn kung (1) aayroong bakante sa hlnthDIng n*
grado (2) kung ang bllang ng nakallstang aag-aaral iy hlndt lalabag sa 1p1nag-uutos ng batas Pederal
.. tAnKpnuauagnntggpukakloaaaolrrnyaaglpsaaaanHntgatanlnAbgaTabstaabnanaagatktaaaagntgklanaryapaslapaatuhsslnalada/kpakuaaupasglyaotknkauaratnisungulasassaudsenanhotnldraInos,hadllnlalgraalaennngskggesnluntyknarouanonngpngagsaaaprnpaagaoglmrkaabaInsakstiaanol(gaagopnagbna)antaSaihafytounSaIOyabanlglpabltulsmpgaagaapnuygagssstsuopoaskauantlrgnaUaatlaaaannsnggag.uglhaaalapnnplgllkhnatnasalylpaonanaga.gralan •• BHftttrtattHWtK-eftf&BtiBttMtt«t.niiBtlfftSctmfMejBfHSfsMltB»fSg»tsf.ijrBststtee.a^-iB*^*f!c*t!t!M.*r,asRt«ts.Pi«flij«k«Su.b?»*Ifi
para s* sentrong panbata kasana ang Hbreng sasakyan. Hindi aalblblgay ang unang pagkakataon sa S-BaBSAHMrtjttHft£B*i>. jfnfl^B«/t;A«*WBB£HB4'4:.
aga mkatakdang tatanggap na paaralan kung angbahag! ng "OER" (Sekslyon 111) ay slnagutan. .
. Ang agi aagulang/lIgal ni tagapag-alaga lyaaaarlng huntling ng hanggang apat (4) na paaralan «wwBXB*«iaB^
sa Sekslyon 111 ng bahag! ng OER. Ang nga paaralan laaang na handa nlnyong tanggapln ang dapat
hlMngln.
. Ang agapag-aplla ayaaaarlng tanggapln laaang pagkatapos ng pangatlong pasutulang pagptH ng Bft' ^ttEBAitBBABBWBHTirteBjJiiarlEgnDBW. il»n-SRfll1
koapyuter na gagaoln sa 1ka-20 ng Hulyo.1993. Ang katapusang araa ng pagtanggap ng pag-aplla ay
Ilkaal-aa0p6asngngAg1oksat-o20.19ng93Agaotstaon.g19s9a3g.ot ay Ipadadala sa nga raagulang/1Igal na tagapag-alaga nang hlndl I«Mf0t».BB*MHWttBH*BBS*#Wi*
. T•Un/uygrUnaghgahalkpalnulndll.llknnaansAyanntoagganpg.rSpauFapbUgaKaStughOan-agtannal.akaadgnabagalaagnapaygyaargnlgtHnaalgngtngaaavaktnpldaganakadrPpaaauayrlngoagkhknlintpdaaaalnnpaggorsa1allsaanaagnghtasatapaktadnnkagaaahnnaollsganynaagannaggbagaa-taptaaguaa.ahsrauaKnnplugatnnlglaaIlynplogaa,nnggppsaaaaantgaeuppaklllraodllnylnlnygsagaanngtgpkaapondaaaglrgpgralyaelaupsaltllnneayrgosannagpya"napggOaakEgarRusa"lualnlgt 2tIWi»Nt»lr-2»*BKB*)f*5«tFMl.«.t^^*lB*nS«*Bkr'MiHBeo-gBrlfiAaCJBj»lAB.Bt<82.t*BlW9BB9-WB3MBB*.B4AJS*J.ifW5K*f8'1M»f9t5i92^F«03^fU*BClc1Bl0T7Ar7qs1eUi«:iiAeJt*»ata.WBfWf»1«I60BlW5lBKBaS<1-•^192M^H9.3nWB^lirkBT8iif(l£lB6S1S6 a
sa ||| sa aga plnlll sa 'OER*.
. aPaaanggg-kabaaatrhaaanlgglgakpnugnngglslllhylaahaaanaayn*nbaanggapogatppaaattlauwknadanay.gsakslaEnPaPCkuarloatlkangsgiaaynolgnoobdIibnanlgldkaHpaakataniggkaoda(pS)nlgetaauraahg»lunlnaaanngag/aypIaIgtgaprlaabpniaahlolsttnagagaaspaaargk-aalaga «H^Kn^t»t«»BI»B»Bei»«»itf«2tim)«ii)idaf3Rtvf»tifU«1t3».ijB»:rfBt»-BB'^6JA«««iB2CB.BBA«£>BBtEBBfttoB(s£1a^aviae«±^»aBBliUsl^B^ljHjAu
nAgT kPoArGeKyAoTAPsaOSlAlHhaGa.BAKTAAPAAGT AMJAIWGAWHAALKA8HAHGNGHAKAR[ATOPATATANHlShADILU6WAARSUHHO1OY.A MSAAMAPAMAARCAALWAGN.BISA ANG PAGKAKAAPRUBA s«*k««.'Itt&irtti^iLfBRBADB*IBfl^WB*WAifBl.»»B.IJemEwPumtn.WmitEBsitat.dmB±^BtHa»tJti-J^iwlt»r.ju.wKT
. uSalatpagnpgapnaelglasttlabonngg braetsaultaangngaagbualkaunnga/sIaIgaTl8 nsaa ntaasgaaspaakgu-paalnagangayIskaangllatnaognangngnapgadgpaalpaalnlgstkaasaslaupkauayraanlgan iBSliMdBBf.l^SB U993 «F 9fl BB^ffJi iblt[llft-«paWB•^£«iflB-^r»j6'JUIX
k(o1akpal-8etonnggSpetaygtsaubsrueM.ng199p3a)n.gkAantga«aagnasakinndaesragsaarktuepnanatngunHaanngggrtaaodno.ng aag-aaral ly kallangan din ang **> ^tfcCB A bj K»ItntF fcfflttfi' KB-^C 3U* M ABM ^tttt'JB
. Isang beses laaang aaaarlng aagpalH o Haaa ngaagulang/1Igal na tagapag-alaga ang pigkUllinlmg
lahl/kultura ng bati habing angaag-aaral lypumipisok si Hmg paaralang paapubllko. ar^aB^iciiE^ajBijB^^iiB/a*.
Oatapwat. angaga pagpapallt ay aagigma laaang sa loob ng nasasakupan ng taong paapaaralan at
hlndl sa panahon ng pagpapalHtahan.
Hlnahangad naaln ang baoat taguapay ng Inyong anak sa daratlng na taong paapaaralan.
JOtCE A: COBLE'. DIRECTOR
EDUCATIONAL PLACEMENT CENTER
f
6 JANUARY 1993
pagcwecklypublishedbySamuel Bran-
MONTH nan. In 1849,San Franciscoestablished
III! itsfirstbank, theExchangeand Deposit
The
Puzzler In San Francisco Office located on KearnySl In 1857, a
4 * 7:45 3.m. earthquake and aftershocks
HISTORY
shook San Francisco, with shocks
Anne K»mrrunm
bn reportedlyfeltasfarawayasSan Diego.
Jan. 16: In 1865, brothers Charles
HAPPY NEW YEAR and Michael H. DeYoung published
WORD LIST
the first issue of the Daily Dramatic
RESOLVE (To be. .do)
LOVING . Chronicle, a free theatre newspaper
GENTLE Jan. 1: In 1954, Alcatraz Island, whichsoongrewinto today'sSan Fran-
formerly a military post, became a
DILIGENT p A s I N C E R E W N C Fcder.il Prison. ciscoChronicle.
PRODUCTIVE Jan. 22: In 1850, theAlta California,
HONEST u R u 6 F R I E N D L Y Jan. 2: In 1921, De YoungMuseum, formed by the merging of the Califor-
TENACIOUS nowapartoftheAcademyofSciences, nian and California Star, the first two
ASSERTIVE N H o N s E T s E N 0 H opened in Golden Gate Parle newspaperspublished inCalifornia, be-
HPUUMNBCLTEUAL c K I D H A P P Y G V E menJacne.d5:onInth1e933G,olcdoensntrGuaclteionBrciodmg-e wchaemen itthsewisttacthee'ds ffirrostmdiatislyprneevwiosupsapterir-
PATIENT T S c I U T F W E N H V when a crew began excavating for the weekly schedule. In 1939, the Aquatic
MarinCountyanchorage. Park, adjacent to Fort Mason in the
GRACIOUS
FRIENDLY U M A L M C H N A I U I Jan 8: In 1880, Joshua Norton, a northern part of the City, was officially
onetime successful City businessman, dedicated.
SINCERE A I R I B A T U R V M T died. When ill-fated grain speculations Jan. 27: In 1894, the Midwinter Fair,
HUMOROUS left him penniless, Norton declared a City event which publicized the
CALM L L G G L L 0 I G 0 0 R himself Emperor of the United States Pacific Coast's mild off-season climatic
SAFE A E R E E M S u V L R E andProtectorofMexico,issuedhisown conditions, opened in Golden Gate
SMILE currencywhichwas sympathetically ac- Park. In 1955, a severe landslide per-
HUG E I V N D R E A M E 0 S cepted by local shopkeepers, and went manentlycloseda stretch ofEl Camino
DREAM on to become one of San Francisco's del Mar, a scenic drive near Land's
HAPPY H P A T I E N T F 0 U S mostcolorful oddball characters. End.
NEW Jan. 9: In 1847, San Francisco, then Jan.30: In 1847, theCity's namewas
YEAR S U 0 I C A N E T E S A known as Verba Buena, issued its first officiallychanged fromYerbaBuena to
newspaper, the California Star, a four- San Francisco.
ARTHRITIS SELF-HELP COURSE tors; howtoexercisewith arthritis; and
The Arthritis Foundation will be how to solve problems caused by
sponsoringArthritisSelf-HelpCourses arthritis. TheyWere San Franciscans busiestbankinghouse in thetown.
waASthIPptionneaoeanarisrrldnetTmnttpleha;eihadMfByecdf-aenheaoielwrnyonpcuaisA.itsadwdrtienbtletvteli1oo1tehsnt9cfo2hlrtC9aly-Saiybe3toeatmveer.iuacineaasocrnsorttnnnotesasmaSnupi,hmegrsCeetooluoeershfwvlwnmur-imelbziettHoeere,ncoheddugta1liMbgiyi0ptcehnono0ateponnCu,tttruiht0oreiwiont0reousiagg0nrrtmrtcrsthiesphao;haneeyeunrmdoirFhaBatopiseoisgnaclebtswe-de.ay.o. 4wTasaAHfmF6hbenirheea4ilboteeley-peArtshkp6sonhfrs2bmftseaei4yoyoioearr0tragoen.nlicitkabd-gnosahydyicvvempualaae.aec,FluinrreodltodeaoetuuTtbsrrswhglfnhsueieeafdealentolnctaefvrhoyocertao2eaportir.laruyhyhorelrooptlfoynsPsauhafr,erlerrtuotetiesnwimalthdadaheiseloseseacotn,ArcossraecnchattSalfhdrlh3swooulie[ir0erlp8tti.neea0tuit0sok0rhsio0ti]-t.es.,nox abhbtMhrreoneoeaatfdnwmnBnMhooaWesosrarsmpprWteIinobeahnnrhcyeeyLgtueroiolinOnihLanhuthnitgiBenliIigmusirgvipto>ieflA2WeocntooiorlsagrMilpeSnhnarllheradiknieiaennssaRowrtMamndfFoinAfPinrsResdnlesaeaahaLiynslnilsgcmscpsspSi.ooijstiasuaoupocrnTltsdpnoatthsiw.vinO,i"aifesRazgirNOaciaeash"rvdrthtiToediiioshrtrnilp,ssegyne vlmcorPghp1yeiachaoa8ravritca7zekSiRrea2museseenl,oacipedirgaeslindbiesfSeeeeroOtHtodnaswuguoonrotnnsthacnebe$nebooflFyu4emnain.rot4pgpnsofa0aaotiresn,nnhnltnuhc0uceailmiii0mskoeacors0Meelldocridfddonloessopflfpshrrroastootaaeoar'shfnrpmfibpetudeietoilhrrcxsocsaepeswt,htwotnmtiiia-sfannsitourtdovhgrtansereieetotsocnshe,miiwiieftoelsrvnnofnnueisgbgrpttxssoasttusaaionihhrbtroitlneke--o-yenf
pendent Party, quite impressedwith his the rugged ibthmus jt Panama. bank'stemporaryclosureonAugust27,
Mayors ofSan Francisco strong stand against the threatened First arriving in San Francisco on 1875. known since then as "Black
1 strangleholdofthe railroads. September 20. 1851. Ralston stayed for Friday" by local businessmen. Mills
JAMES OTIS Nominated as the party's mayoral good in 1854 when he and a partner would later come out of retirement to
candidatein 1873,Otiswonacloseelec- becameagents forsteamers byforming reorganize and reopen the Bank of
When William Atvord was mayorof tion, takingofficeon December L the Accessory Transit Company. In California,resuminghisoriginalpostas
San Francisco, hisdesiresforchildren's During his term, Otis was quite January, 1856, be and three other president.
housing and an expanded police force adept in making his feelings known of partnersopened a bankinghouse. Rattled, but still in optimistic spirit
throughofficers'salary reductions met rhe then deplorable state of the City's Alongwith businessman D.O. Mills, thedayafterhisbank'sclosure, Ralston
withgreatresistancefrom City officials streetsandsewersystem,adesirewhichI Ralston helped establish the Bank of went for his usual swim in the bay off
questioningwhat they thought was im- stemmed from his fear of plague. San California in 1864. the first incor- Hyde St. never to return to dry land.
practical ideology, despite the rapidly Francisco was also experiencing grow- poratedbankin thestate. Mills became Hisaccidentaldrowningattheageof49
.growing local population. Such inganti-Chinese sentiment, as many of bank president, and Ralston served as sadlyoccured justfiveweeks before the
A
negativity, coupled with Aivord's im- the townspeople seemed convinced its first cashier. branch office was gala opening of the Palace Hotel on
mense interestin avariety oforganiza- thatthe newwaveofworkingmen from eventually established in bustling Vir- October3.
tions in which he participated com- the Orient was depleting the local job' ginia City, Nevada at the height of the RalstonSlintheCity'sInglesidedis-
pelledhim todeclineseekingreelection market at considerably reduced wages. bigsilverbonanza, soon to become the trictisnamed in his honor.
in 1873. He insteadendorsed the selec- Some citizens even went so far as to
tion of fellow City businessman James createaWorkingman's Party, nominat- GRAPEVINE CROSSWORD #1
Otis. ing Andrew Bryant as their mayoral
Born in Boston, Massachusetts on candidate in 1875. ACROSS
August 11. 1826, Otis firstworked as a Not wishing to go against the grain, 61.. CTreoxstsure
mercantile clerk before jumping at the Otis planned to complete his two-year 10. Ancient
offertobecomeapartnerofaSan Fran- term and return to the importingbusi- 1121.. PPreotmrionleenutm
ciscofirm. Arrivingin the BayAreaon ness, but he never got the chance. He 16. Adhesive
wAiutghusthte23F,.W1.849M,aOctriosnsdpaeynt&thCroeempyeaanrys cdyaimneg dinowonffiwciethondipOtchteoribaerin30t.he18f7al5l., 211198... ARSneoyvuitshoeneDakota
importinghousebeforeleavingtheCity Afterconveninginaspecialsession,the 22. Twice five
toreturn forgood in 1858to reacquire Board of Supervisors voted to appoint 2235.. BEolletvated train
his partnership and marry the boss's Supervisor George Hewston to com- 26. Molar
daughter. plete the month Otis had remainingof 27. Air motion
Elected to the S.F. Board ofSuper- his term. 2290.. NSoorutthheaDsatkota
visors in 1859, both bis political and OtisSL,namedtorthefirstSanFran- 31. Therefore
bmuasdienemsasndyeapleionpglseolvaekretnhoeten,exetspdeecicaaldley jcaicsceontmtaoyoMrisstioodnieSt.inboeftfwiceee,nrDuunsboacde- 333245... EFSoxcoiolsrtn
the newly forming People's Inde- St.andSouth Van NessAve. 37. You
39. Pontif
40. Except
11. Again
12. Quality
we serve with honesty & dependability 45. Bromine
FOR YOU - we buy, sell, trade, 4468.. MCursuisctaalceahnigh
rent, manage 49. Writing liquid
52. Dog
53. Shades
HENRY 54. Docile
SCHINDEL
13. Aboard 35. Substantive
Real Estate Broker DOWN 1154.. EEnxcpoiuartaege 3367.. DYoruinking vessels SOLUTION
1. Dweller 17. Application 39. Establish
91 Leland Avenue 239-5850 453... SEFdnuiontwcitoivnoenhicle 222024... BPLiriremdsietnetd 444534... BOPacatcsutrtime NEXT ISSUE
San Francisco 94134 6. Proceed 28. Mechanical man 47. Metal
7. Proper 31. Over 49. Golf peg
8. Whole 33. Europium 51. Kansas
34. Accomplish 52. Colorado