Table Of ContentUnsupervised Alignment of Natural
Language with Video
by
Iftekhar Naim
Submitted in Partial Fulfillment
of the
Requirements for the Degree
Doctor of Philosophy
Supervised by
Professor Daniel Gildea
Department of Computer Science
Arts, Sciences and Engineering
Edmund A. Hajim School of Engineering and Applied Sciences
University of Rochester
Rochester, New York
2015
ii
Tomygrandparents
iii
Biographical Sketch
Iftekhar Naim completed his Bachelor of Science degree in Computer Science in 2007
from Bangladesh University of Engineering and Technology (BUET). From 2007-
2008,heworkedasaSoftwareEngineeratSpectrumEngineeringConsortium,Dhaka,
Bangladesh. In 2008, he moved to Rochester, NY, and completed a Master of Sci-
ence degree in Electrical and Computer Engineering from the University of Rochester.
He joined the PhD program in the Computer Science Department at the University of
Rochester in 2011, under the supervision of Prof. Daniel Gildea. He did several re-
searchinternshipsatBoschResearchandGoogleInc. HeisastudentmemberofIEEE,
AAAI,andACL.
iv
Acknowledgments
First and foremost, I would like to thank my advisor Daniel Gildea, who has always
been kind and supportive. I have learned so many things from Dan, both regarding
academic research and personal values. Despite being busy with his own research and
teaching,Danalwaysprovidedmeplentyoftime,whetherit’sregardingwritingpapers,
figuring out mathematical details of my models, or even providing insights regarding
possible bugs in my code. Most importantly, Dan always encouraged me to pursue
my ideas and guided me to remain on the right track. I hope to follow his examples
and treat my future colleagues and collaborators with the same level of sincerity and
commitment.
I would like to thank Henry Kautz for introducing me to this exciting domain of
‘language and vision’ and for including me in the wetlab project. It was a great plea-
sure working with Henry and making progress with the project, which became the
primary focus of my dissertation. I am also grateful to Henry for believing in me and
forintroducing methetomanygreatresearchersinmyarea.
IfeelfortunatetohaveEhsanHoquejoiningourdepartmentatthebeginningofthe
third year. Ehsan has been an incredible mentor. From Ehsan, I learned to step back
from the technical details from time to time, and to look at the bigger picture. Ehsan
has a great quality of inspiring people around him, and I always felt more energized
and motivated after our meetings. I am also thankful to Ehsan for providing me the
opportunities togiveguestlecturesinhisclasses.
v
IwouldliketothankmyexternalcommitteemembersStevePiantadosiandRobert
Jacobsforalwaysbeingaccommodatingwiththeirtimeandforprovidingtheirvaluable
inputregardingmyresearch. IamalsogratefultoJieboLuo,LiangHuang,andJeffery
BighamfortheircommentsandsuggestionsindifferentphasesofmyPhDstudies.
I have been fortunate to collaborate with several graduate students in our depart-
ment. I would like to thank Young Chol Song and Qiguang Liu for helping me with
video processing and contributing to the papers that we wrote together. I am grateful
to Iftekhar Tanveer, not only for his help with the job interview project, but also for
many fun conversations that we regularly had in the coffee shops around campus. I
would like to thank Walter Lasecki for all his help with the crowd captioning project.
MyspecialthanksgoestoAbdullahAlMamun,anamazingundergraduatestudentand
my research collaborator, for his hard work and commitment to AI research. I am also
gratefultotheamazingstaffmembers,especiallyMarty,Pat,JoMarie,Eileen,andNiki,
myfellowgraduatestudents,andthefacultymembersatURCS,whoalwaystreatedme
kindly.
My life at Rochester became so much more eventful and memorable for my amaz-
ing friends, who made Rochester my second home. I am incredibly grateful to my
Rochester family, especially Naushad, Talat, Ashker, Farzana apu, Zobayer bhai, Akhi
bhabi, Naseef, Pappu, Nishi, Juni, Tonima, Tasnif, Tonmoy, Anis, Towhid, and Tousif.
I would also like to thank my friends and collaborators at the University of Rochester:
Amal,Phyo,Rahman,Roya,Pencheng,Xiaochang,Licheng,Mariyam,Tag,Lingfeng,
Nasrin, Omid, Adam, and my past lab-mates Chao, Orhan, Carlos, Arif, Basak, and
Andy. I am also thankful to my best friends, especially Enamul, Tanima, Shafi, Sagar,
Laboni,Shahan,andAtifforallthefuntimeswespenttogether.
Finally,Iwouldliketothankmylovingfamilyfortheirnever-endingsupport. Iam
extremely thankful to my mother, Dr. Nayeema Kabir, for always being there for me.
Eventhoughwehavebeenlivingondifferentcontinents,shehasalwaysbeeninformed
abouteverylittledetailsofmygradlifeandalwaysinspiredandsupportedme. Iwould
vi
like to thank my wonderful sister, Anisia, and my brilliant nephew, Ayman, who have
been living with me for the last year and sharing many moments of happiness. I am
gratefultoMaa,Baba,Nanu,Rinukhala,andBenookhalafortheirunconditionallove
andtoNitu,Tasbir,andEshaanforbeingacontinuous sourceofjoy.
Iamfortunatetohaveawonderfulwife,Shantonu,whohasbeenextremelyloving,
caring, and supportive in every possible way. The happiest period of my grad life was
thefirsttwoyears,whenshelivedinRochesterwithme. Eventhough shehadtoleave
Rochester for her job, we continued sharing every moment of happiness and sadness,
celebrated every success together, and supported each other in the times of failure. I
amsohappythatwewillbetogetheragainaftermygraduation.
I would like to acknowledge my grandmother and my late grandfather, to whom
I dedicate my thesis. They have been the greatest gifts in my life, and I regret not
spending more time with them. Even though my grandfather passed away, I feel his
presenceinthepagesofhisbooksandinmyrandomthoughts. Ihopetorememberthe
valuesthattheytaughtmeandleadanhonestandsimplelifelikethem.
vii
Abstract
Todayweencounterlargeamountsofvideodata,oftenaccompaniedwithtextdescrip-
tions (e.g., cooking videos and recipes, videos of wetlab experiments and protocols,
movies and scripts). Extracting meaningful information from these multimodal se-
quences requires aligning the video frames with the corresponding sentences in the
text. Previous methods for connecting language and videos relied on manual anno-
tations, which are often tedious and expensive to collect. In this thesis, we focus on
automatically aligning sentences with the corresponding video frames without any di-
recthumansupervision.
We first propose two hierarchical generative alignment models, which jointly align
each sentence with the corresponding video frames, and each noun in a sentence with
the corresponding object in the video frames. Next, we propose several latent-variable
discriminative alignment models, which incorporate rich features involving verbs and
videoactions,andoutperformthegenerativemodels. Ouralignmentalgorithmsarepri-
marilyappliedtoalignbiologicalwetlabvideoswithtextinstructions. Furthermore,we
extend our alignment models for automatically aligning movie scenes with associated
scriptsandlearningword-leveltranslationsbetweenlanguagepairsforwhichbilingual
training dataisunavailable.
Thesis: By exploiting the temporal ordering constraints between video and associ-
ated text, it is possible to automatically align the sentences in the text with the corre-
spondingvideoframeswithout anydirecthumansupervision.
viii
Contributors and Funding Sources
This work was supervised by a dissertation committee consisting of Professors Daniel
Gildea, Henry Kautz, and M. Ehsan Hoque from the Department of Computer Science
and Professors Steve Piantadosi and Robert Jacobs from the Department of Brain and
Cognitive Science of the University of Rochester. In Chapter 3 and Chapter 4, Young
Chol Song and Qiguang Liu helped with video processing, segmentation, and track-
ing. Professor Jiebo Luo provided many helpful suggestions for all the tasks related to
computer vision. Professor Liang Huang helped with his valuable comments and sug-
gestionsforthediscriminativealignmenttask(Chapter4). AbdullahAlMamunhelped
withannotatinggroundtruthlabelsformovietracks,andprovidedgreatsupportonthe
movie-to-script alignment project (Chapter 5). Md. Iftekhar Tanveer and Leon Wein-
gard helped with analyzing the job interview dataset. I also collaborated with Walter
Lasecki, Mohammad Kazemi, and Jeffrey Bigham for the real-time crowd-captioning
project. All other work conducted for the dissertation was completed by the student
independently. Work presented here was supported by NSF grants IIS-1446996, IIS-
1449278,IntelISTC-PC,andONRN00014-11-10417.
ix
Table of Contents
BiographicalSketch iii
Acknowledgments iv
Abstract vii
ContributorsandFundingSources viii
ListofTables xii
ListofFigures xiv
1 Introduction 1
1.1 MotivationandOverview . . . . . . . . . . . . . . . . . . . . . . . . . 1
1.2 SummaryofPrimaryContributions . . . . . . . . . . . . . . . . . . . . 4
1.3 OtherRelevantContributions . . . . . . . . . . . . . . . . . . . . . . . 7
1.4 ThesisOutline . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
2 GroundedLanguageLearning: Background 12
2.1 GroundedLanguageLearningforConnectingLanguagewithVision . . 12
2.2 ExistingResearchonGrounded LanguageLearning . . . . . . . . . . . 13
x
2.3 FullySupervisedApproaches . . . . . . . . . . . . . . . . . . . . . . . 14
2.4 Semi-supervisedApproaches . . . . . . . . . . . . . . . . . . . . . . . 16
2.5 OurContribution: UnsupervisedGroundedLanguageLearning . . . . . 19
3 GenerativeAlignmentModels 25
3.1 Overview . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25
3.2 AligningWetlabProtocolswithVideos . . . . . . . . . . . . . . . . . . 26
3.3 ProblemFormulationandNotations . . . . . . . . . . . . . . . . . . . 30
3.4 GenerativeModelsforJointAlignment . . . . . . . . . . . . . . . . . 31
3.5 ExperimentalResults . . . . . . . . . . . . . . . . . . . . . . . . . . . 37
3.6 RelatedWorksandDiscussions . . . . . . . . . . . . . . . . . . . . . . 39
3.7 FutureDirections . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40
4 DiscriminativeAlignmentModels 43
4.1 MotivationandOverview . . . . . . . . . . . . . . . . . . . . . . . . . 43
4.2 RelatedWork . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44
4.3 DiscriminativeAlignment . . . . . . . . . . . . . . . . . . . . . . . . . 45
4.4 FeatureDesign . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54
4.5 ExperimentalResults . . . . . . . . . . . . . . . . . . . . . . . . . . . 57
4.6 DiscussionsandFutureWork . . . . . . . . . . . . . . . . . . . . . . . 58
5 AligningMovieswithScripts 62
5.1 OverviewandMotivation . . . . . . . . . . . . . . . . . . . . . . . . . 63
5.2 RelatedWork . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 66
5.3 DataProcessingPipeline . . . . . . . . . . . . . . . . . . . . . . . . . 72
5.4 ExperimentalResults . . . . . . . . . . . . . . . . . . . . . . . . . . . 78
5.5 ConclusionandFutureWork . . . . . . . . . . . . . . . . . . . . . . . 82
Description:from Bangladesh University of Engineering and Technology (BUET). bhabi, Naseef, Pappu, Nishi, Juni, Tonima, Tasnif, Tonmoy, Anis, Towhid, and Tousif. We design and implement several generative alignment models for aligning nat- .. of improvement in web-scale text search algorithms.