Table Of ContentSpringer Handbook
of Robotics
SpringerHandbooksprovide
aconcisecompilationofapproved
key information on methods of
research, general principles, and
functional relationships in physi-
cal sciences and engineering. The
world’sleadingexpertsinthefields
ofphysicsandengineeringwillbe
assignedbyoneorseveralrenowned
editors to write the chapters com-
prising each volume. The content
is selected by these experts from
Springer sources (books, journals,
onlinecontent)andothersystematic
andapprovedrecentpublicationsof
physicalandtechnicalinformation.
Thevolumesaredesignedtobe
useful as readable desk reference
bookstogiveafastandcomprehen-
siveoverviewandeasyretrievalof
essential reliable key information,
includingtables,graphs,andbibli-
ographies.Referencestoextensive
sourcesareprovided.
Springer
Handbook
of Robotics
Bruno Siciliano, Oussama Khatib (Eds.)
WithDVD-ROM,953Figures,422infourcolorand84Tables
123
Editors:
ProfessorBrunoSiciliano
PRISMALab
DipartimentodiInformaticaeSistemistica
UniversitàdegliStudidiNapoliFedericoII
ViaClaudio21,80125Napoli,Italy
[email protected]
ProfessorOussamaKhatib
ArtificialIntelligenceLaboratory
DepartmentofComputerScience
StanfordUniversity
Stanford,CA94305-9010,USA
[email protected]
LibraryofCongressControlNumber: 2007942155
ISBN:978-3-540-23957-4 e-ISBN:978-3-540-30301-5
Thisworkissubjecttocopyright.Allrightsreserved,whetherthewhole
orpartofthematerialisconcerned,specificallytherightsoftranslation,
reprinting,reuseofillustrations,recitation,broadcasting,reproductionon
microfilmorinanyotherway,andstorageindatabanks.Duplicationof
thispublicationorpartsthereofispermittedonlyundertheprovisionsof
theGermanCopyrightLawofSeptember,9,1965,initscurrentversion,
andpermissionforusemustalwaysbeobtainedfromSpringer-Verlag.
ViolationsareliableforprosecutionundertheGermanCopyrightLaw.
SpringerisapartofSpringerScience+BusinessMedia
springer.com
(cid:2)c Springer-VerlagBerlinHeidelberg2008
Theuseofdesignations,trademarks,etc.inthispublicationdoesnotimply,
evenintheabsenceofaspecificstatement,thatsuchnamesareexemptfrom
therelevantprotectivelawsandregulationsandthereforefreeforgeneral
use.
Product liability: The publisher cannot guarantee the accuracy of any
informationaboutdosageandapplicationcontainedinthisbook.Inevery
individualcasetheusermustchecksuchinformationbyconsultingthe
relevantliterature.
Productionandtypesetting:le-texpublishingservicesoHG,Leipzig
SeniorManagerSpringerHandbook:Dr.W.Skolaut,Heidelberg
Typographyandlayout:schreiberVIS,Seeheim
Illustrations:HippmannGbR,Schwarzenbruck
Coverdesign:eStudioCalamarSteinen,Barcelona
Coverproduction:WMXDesignGmbH,Heidelberg
Printingandbinding:StürtzGmbH,Würzburg
Printedonacidfreepaper
SPIN10918401 89/3180/YL 543210
V
Foreword
Myfirstintroductiontoroboticscameviaaphonecall exoskeletaldevicestoenhancehu-
in1964.ThecallerwasFredTerman,theauthorofthe man performance. In those days
world-famous Radio Engineer’s Handbook, who was therewerenomicroprocessors.So,
atthetimeProvostofStanfordUniversity.Dr.Terman these devices were either without
informed me that a computer science professor, John computer control, or tethered to
McCarthy,hadjustbeenawardedalargeresearchgrant, a remote so-called minicomputer,
part of which required the development of computer- orevenamainframecomputer.
controlled manipulators. Someone had suggested to Initially, some in the computer
Terman that it would be prudent if the mathematically science community felt that com-
oriented McCarthy had some contact with mechanical puters were powerful enough to
designers. Since I was the only one on the Stanford controlanymechanicaldeviceand
facultywhosespecialtywasmechanismdesign,Terman make it perform satisfactorily. We BernardRoth
decidedtophoneme,eventhoughwehadnevermetand quicklylearnedthatthiswasnotto ProfessorofMechanical
Engineering
Iwasayoungassistantprofessorfreshoutofgraduate bethecase.Westartedonatwofold
StanfordUniversity
schoolwithonly2yearsatStanford. track. One was to develop particu-
Dr.Terman’sphonecallledmetoacloseassociation lar devices for SAIL, so that hardware demonstrations
with John McCarthy and the Stanford Artificial Intel- and proof-of-concept systems were available for the
ligence Laboratory (SAIL) that he founded. Robotics fledgling robotics community to experiment with. The
became one of the pillars of my entire academic ca- othertrack,whichwasmoreorlessmoonlightedfrom
reer,andIhavemaintainedmyinterestinteachingand theworkatSAIL,wasthedevelopmentofabasicme-
researchingthesubjectthroughtothepresentday. chanicalscienceofrobotics.Ihadastrongfeelingthat
The modern history of robotic manipulation dates a meaningful science could be developed, and that it
fromthelate1940swhenservoedarmsweredeveloped wouldbebesttothinkintermsofgeneralconceptsrather
in connection with master–slave manipulator systems thanconcentrateexclusivelyonparticulardevices.
used to protecttechnicians handlingnuclearmaterials. Fortuitously, it turned out that the two tracks sup-
Developmentsinthisareahavecontinuedtothepresent portedeachotherverynaturallyand,mostimportantly,
day. However, in the early 1960s there was very little the right students were interested in doing their re-
academic or commercial activity in robotics. The first search in this area. Hardware developments proved to
academicactivitywasthethesisofH.A.Ernst,in1961, bespecificexamplesofmoregeneralconcepts,andthe
atMIT.Heusedaslavearmequippedwithtouchsensors, studentswereabletodevelopboththehardwareandthe
andranitundercomputercontrol.Theideainhisstudy theory.
was to use the information from the touch sensors to Originally, we purchased an arm in order to get
guidethearm. started quickly. A group at Rancho Los Amigos
ThiswasfollowedbytheSAILprojectandasimi- Hospital,inLosAngeles,wassellingatongue-switch-
larprojectstartedbyProfessorMarvinMinskyatMIT, controlled motor-driven exoskeleton arm to assist
which were the only sizeable academic ventures into patientswithoutmuscularcontroloftheirarms.Wepur-
roboticsatthattime.Therewereafewattemptsatcom- chased oneofthese, and connectedit to atime-shared
mercialmanipulators,primarilyinconnectionwithpart PDP-6computer.ThedevicewasnamedButterfingers;it
productionintheautomotiveindustry.IntheUSAthere wasourfirstexperimentalrobot.Severalfilmsdemon-
weretwodifferentmanipulatordesignsthatwerebeing strating visual feedback control, block stacking tasks,
experimentedwithintheautoindustry;onecamefrom andobstacleavoidanceweremadewithButterfingersas
American Machine and Foundry (AMF) and the other thestarperformer.
fromUnimation,Inc. Thefirstmanipulatorthatwedesignedonourown
Therewerealsoafewmechanicaldevicesdeveloped was known simply as the HydraulicArm. As its name
ashand,leg,andarmprosthetics,and,abitlater,some implies, it was powered by hydraulics. The idea was
VI
to build a very fast arm. We designed special rotary leftUnimation,hiscolleaguesBrianCarlisleandBruce
actuators, and the arm worked well. It became the ex- ShimanoreorganizedUnimation’sWestCoastDivision
perimental platform for testing the first ever dynamic into Adept, Inc., which to this day is the largest US
analysisandtime-optimalcontrolofaroboticarm.How- manufacturerofassemblyrobots.
ever, its use was limited since the design speeds were Quickly,themoderntrendofcarefullydetailedme-
much faster than required due to the limitationsof the chanicalandelectronicdesign,optimizedsoftware,and
computational, planning, and sensing capabilities that complete system integration became the norm; to this
werecommonatthattime. day, this combination represents the hallmark of most
Wemadeanattempttodevelopatrulydigitalarm. highly regarded roboticdevices. This is the basic con-
This led to a snake-like structure named the Orm (the cept behind mechatronic, a word conied in Japan as
Norwegianwordforsnake.)TheOrmhadseveralstages, aconcatenationofthewordsmechanicsandelectronics.
eachwithanarrayofinflatablepneumaticactuatorsthat Mechatronicsthatreliesoncomputationistheessence
wereeitherfullyextendedorfullycontracted.Thebasic of the technology inherent in robotics as we know it
ideawasthat,eventhoughonlyafinitenumberofpo- today.
sitionsintheworkspacecouldbereached,thesewould As robotics developed around the world, a large
besufficientiftherewerealargenumberofpositions. number of people started working on various aspects,
Asmallprototypeproof-of-conceptOrmwasdeveloped. and specific subspecialties developed. The first big di-
Itledtotherealizationthatthistypeofarmwouldnot vision was between people working on manipulators
reallyservetheSAILcommunity. and those working on vision systems. Early on, vi-
The first truly functional arm from our group was sion systems seemed to hold more promise than any
designedbyVictorScheinman,whowasagraduatestu- othermethodforgivingrobotsinformationabouttheir
dentatthetime.ItwastheverysuccessfulStanfordArm, environment.
of which over ten copies were made as research tools The idea was to have a television camera capture
tobeusedinvariousuniversity,government,andindus- pictures of objects in the environment, and then use
triallaboratories.Thearmhadsixindependentlydriven algorithms that allowed the computer images of the
joints; all driven by computer-controlled servoed, DC pictures to be analyzed, so as to infer required infor-
electric motors. One joint was telescoping (prismatic) mationaboutlocation,orientation,andotherproperties
andtheotherfivewererotary(revolute). of objects. The initial successes with image systems
WhereasthegeometryofButterfingersrequiredan wereinproblemsdealingwithpositioningblocks,solv-
iterativesolutionoftheinversekinematics,thegeomet- ingobjectmanipulationproblems,andreadingassembly
ric configuration of the Stanford Arm was chosen so drawings. It was felt that vision held potential for use
thattheinversekinematicscouldbeprogrammedinany in robotic systems in connection with factory automa-
easy-to-usetime-efficientclosedform.Furthermore,the tion and space exploration. This led to research into
mechanicaldesignwasspecificallymadetobecompat- software that would allow vision systems to recognize
iblewiththelimitationsinherentintimesharecomputer machine parts (particularlypartially occludedparts, as
control. Various end-effectors could be attached to act occurred in the so-called “bin-picking” problems) and
as hands. On our version, the hand was in the form ragged-shapedrocks.
of a vise-grip jaw, with two sliding fingers driven by Aftertheabilityto“see”andmoveobjectsbecame
aservoedactuator(hence,atrueseventhdegreeoffree- established,thenext logical need had to do with plan-
dom).Italsohadaspeciallydesignedsix-axiswristforce ningasequenceofeventstoaccomplishacomplextask.
sensor.VictorScheinmanwentontodevelopotherim- This led to the development of planning as an impor-
portantrobots:thefirstwasasmallhumanoidarmwith tantbranchinrobotics.Makingfixedplansforaknown
sixrevolutejoints.Theoriginaldesignwaspaidforby fixed environment is relatively straightforward. How-
MarvinMinskyattheMITAILab.Scheinmanfounded ever, in robotics, one of the challenges is to let the
Vicarm, asmallcompany, andproducedcopiesofthis robot discover its environment, and to modify its ac-
armandtheStanfordArmforotherlabs.Vicarmlaterbe- tionswhentheenvironmentchangesunexpectedlydue
cametheWestCoastDivisionofUnimation,Inc.,where toerrorsorunplannedevents.Someearlylandmarkstud-
ScheinmandesignedthePUMAmanipulatorunderGen- iesinthisareawerecarriedoutusingavehiclenamed
eralMotorssponsorshipthroughUnimation.Later,for Shakey,which,startingin1966,wasdevelopedbyChar-
acompanycalledAutomatix,Scheinmandevelopedthe lie Rosen’s group at the Stanford Research Institute
novelRobotWorldmultirobotsystem.AfterScheinman (now called SRI). Shakey had a TV camera, a trian-
VII
gulatingrangefinder,bumpsensors,andwasconnected tions were formed (the Japan Robot Association was
to DEC PDP-10 and PDP-15 computers via radio and formedinMarch1971,andtheRoboticIndustriesAs-
videolinks. sociation(RIA)wasfoundedin1974intheUSA)and
Shakey was the first mobile robot to reason about tradeshows,togetherwithapplication-orientedtechni-
its actions. It used programs that gave it the abil- calsessions,wereintroducedandheldonaregularbasis.
ity for independent perception, world modeling, and ThemostimportantweretheInternationalSymposium
action generation. Low-level action routines took onIndustrialRobots,theConferenceonIndustrialRobot
care of simple moving, turning, and route planning. Technology(nowcalledtheInternationalConferenceon
Intermediate-levelactionscombinedthelow-levelones IndustrialRobotTechnology),andtheRIAannualtrade
in ways that accomplished more complex tasks. The show,whichisnowcalledtheInternationalRobotsand
highestlevelprogramscouldmakeandexecuteplansto VisionShowandConference.
achievehigh-levelgoalssuppliedbyauser. Thefirstregularseriesofconferencesemphasizing
Visionisveryusefulfornavigation,locatingobjects, research,ratherthantheindustrial,aspectsofrobotics,
anddeterminingtheirrelativepositionsandorientation. wasinauguratedin1973.Itwassponsoredjointlybythe
However,itisusuallynotsufficientforassemblingparts International Center for Mechanical Sciences (CISM),
or working with robots where there are environmental based in Udine, Italy, and the International Federation
constrainingforces.Thisledtotheneedtomeasurethe fortheTheoryofMechanismsandMachines(IFToMM).
forces and torques generated by the environment, on (AlthoughIFToMMisstillused,itsmeaninghasbeen
a robot, and to use these measurements to control the changed to the International Federation for the Pro-
robot’s actions. For many years, force-controlled ma- motion of Mechanism and Machine Science.) It was
nipulation became one of the main topics of study at namedtheSymposiumonTheoryandPracticeofRobots
SAIL,andseveralotherlabsaroundtheworld.Theuse and Manipulators (RoManSy). Its trademark was an
offorcecontrolinindustrialpracticehasalwayslagged emphasis on the mechanical sciences and the active
the research developments in this area. This seems to participation of researchers from Eastern and Western
be due to the fact that, while a high level of force Europe as well as North America and Japan. It is still
control is very useful for general manipulation issues, held biannually. On a personal note, it is at RoManSy
specific problems in very restricted industrial environ- whereIfirstmeteachoftheeditorsofthisHandbook:
ments can often be handled with limited, or no, force Dr.Khatibin1978andDr.Sicilianoin1984.Theywere
control. bothstudents:BrunoSicilianohadbeenworkingonhis
In the 1970s, specialized areas of study such as PhD for about one year, and Oussama Khatib had just
walking machines, hands, automated vehicles, sensor completedhisPhDresearch.Inbothcases,itwaslove
integration, and design for hostile environments began atfirstsight!
todeveloprapidly.Todaytherearealargenumberofdif- RoManSy was quickly joined by a host of other
ferentspecialtiesstudiedundertheheadingofrobotics. newconferencesandworkshops;todaytherearealarge
Someofthesespecialtiesareclassicalengineeringsub- numberofresearchorientedroboticsmeetingsthattake
jectareaswithinwhichresultshavebeendevelopedthat place through the year in many countries. Currently,
havebeenparticularizedtothetypesofmachinescalled the largest conference is the International Conference
robots. Examples here are kinematics, dynamics, con- on Robotics and Automation (ICRA), which regularly
trols,machinedesign,topology,andtrajectoryplanning. drawswellover1000participants.
Eachofthesesubjectshasalonghistorypredatingthe In the beginning of the 1980s, the first real text-
studyofrobotics;yeteachhasbeenanareaofin-depth book on robotic manipulation in the USA was written
roboticsresearchinordertodevelopitsspecialcharac- byRichard“Lou”Paul(RichardP.Paul,RobotManip-
ter in regard to robotic-type systems and applications. ulators:Mathematics,Programming,andControl,The
Indoingthisspecializeddevelopment,researchershave MIT Press, Cambridge, MA, 1981). It used the idea
enrichedtheclassicalsubjectsbyincreasingboththeir of taking classical subjects in mechanics and applying
contentandscope. them to robotics. In addition there were several top-
At the same time that the theory was being devel- icsdevelopeddirectlyfromhisthesisresearchatSAIL.
oped,therewasaparallel,althoughsomewhatseparate, (Inthebook,manyexamplesarebasedonScheinman’s
growthofindustrialrobotics.Strongcommercialdevel- Stanford Arm.) Paul’s book was a landmark event in
opment occurred in Japan and Europe, and there was the USA; it created a pattern for several influential
also continued growth in the USA. Industrial associa- future textbooks and also encouraged the creation of
VIII
specialized robotics courses at a host of colleges and peoplegetusedtotheactivitybeingdonebymachines,
universities. and the devices get downgraded from “robot” to “ma-
Ataboutthissametime,newjournalswerecreated chine”.Machinesthatdonothavefixedbases,andthose
to deal primarily with research papers in the areas re- that have arm- or leg-like appendages have the advan-
latedtorobotics.TheInternationalJournalofRobotics tageofbeingmorelikelycalledrobots,butitishardto
Researchwasfoundedinthespringof1982,andthree thinkofaconsistentsetofcriteriathatfitsallthecurrent
yearslatertheIEEEJournalofRoboticsandAutomation namingconventions.
(nowtheIEEETransactionsonRobotics)wasfounded. Inactualityanymachines,includingfamiliarhouse-
As microprocessors became ubiquitous, the ques- holdappliances,whichhavemicroprocessorsdirecting
tion of what is or is not a robot came more into play. their actions can be considered as robots. In addition
This issue has, in my mind, never been successfully tovacuumcleaners,therearewashingmachines,refrig-
resolved.Idonotthinkadefinitionwilleverbeuniver- erators,anddishwashersthatcouldbeeasilymarketed
sallyagreedupon.Thereareofcoursethesciencefiction as robotic devices. There are of course a wide range
creatures-from-outer-space varieties, and the robots of of possibilities, including those machines that have
the theater, literature, and the movies. There are ex- sensory environmental feedback and decision-making
amples of imaginary robot-likebeings that predatethe capabilities. In actual practice, in devices considered
industrialrevolution,buthowaboutmoredown-to-Earth to be robotic, the amount of sensory and decision
robots?Inmyviewthedefinitionisessentiallyamov- making capability may vary from a great deal to
ingtargetthatchangesitscharacterwithtechnological none.
progress. For example, when it was first developed, Inrecentdecadesthestudyofroboticshasexpanded
aship’sgyroauto-compasswasconsideredarobot.To- fromadisciplinecenteredonthestudyofmechatronic
day,itisnotgenerallyincludedwhenwelisttherobots devices to a much broader interdisciplinary subject.
inourworld.Ithasbeendemotedandisnowconsidered An example of this is the area called human-centered
anautomaticcontroldevice. robotics. Here one deals with the interactionsbetween
For many, the idea of a robot includes the concept humansandintelligentmachines.Thisisagrowingarea
of multifunctionality, meaning the device is designed wherethestudyoftheinteractionsbetweenrobotsand
andbuiltwiththeabilitytobeeasilyadaptedorrepro- humans has enlisted expertise from outside the classi-
grammed to do different tasks. In theory this idea is calroboticsdomain.Conceptssuchasemotionsinboth
valid, but in practice it turns out that most robotic de- robotsandpeoplearebeingstudied,andolderareassuch
vices are multifunctional in only a very limited arena. ashumanphysiologyandbiologyarebeingincorporated
Inindustryitwasquicklydiscoveredthataspecialized intothemainstreamofroboticsresearch.Theseactivi-
machine,ingeneral,performsmuchbetterthanagen- ties enrich the field of robotics, as they introduce new
eralpurposemachine.Furthermore,whenthevolumeof engineering and science dimensions into the research
production is high enough, a specialized machine can discourse.
costlesstomanufacturethanageneralizedone.So,spe- Originally,thenascentroboticscommunitywasfo-
cialized robots were developed for painting, riveting, cused on getting things to work. Many early devices
quasiplanarpartsassembly,pressloading,circuitboard were remarkable in that they worked at all, and little
stuffing,etc.Insomecasesrobotsareusedinsuchspe- notice was taken of their limited performance. Today,
cializedwaysthatitbecomesdifficulttodrawtheline we have sophisticated, reliable devices as part of the
between a so-called robot and an adjustable piece of modern array of robotic systems. This progress is the
“fixed”automation.Muchofthispracticalunfoldingis result of the work of thousands of people throughout
contrary to the dream of the pioneers in robotics, who the world. A lot of this work took place in universi-
hadhopedforthedevelopmentofgeneralpurposema- ties,governmentresearchlaboratories,andcompanies.
chines that would do “everything”, and hence sell in It is a tribute to the worldwide engineering and scien-
greatenoughvolumetoberelativelyinexpensive. tificcommunitythatithasbeenabletocreatethevast
Myviewisthatthenotionofarobothastodowith amountofinformationthatiscontainedinthe64chap-
which activities are, at a given time, associated with tersofthisHandbook.Clearlytheseresultsdidnotarise
peopleandwhichareassociatedwithmachines.Ifama- byanycentralplanningorbyanoverallorderlyscheme.
chine suddenly becomes able to do what we normally Sotheeditorsofthishandbookwerefacedwiththedif-
associatewithpeople,themachinecanbeupgradedin ficulttaskoforganizingthematerialintoalogicaland
classification and classified as a robot. After a while, coherentwhole.
IX
Theeditorshaveaccomplishedthisbyorganizingthe Thethirdlayerconsistsoftwoseparateparts(atotal
contributionsintoathree-layerstructure.Thefirstlayer of22chapters)thatdealwithadvancedapplicationsat
deals with the foundations of the subject. This layer theforefrontoftoday’sresearchanddevelopment.There
consists of a single part of nine chapters in which the aretwopartstothislayer;onedealswithfieldandservice
authorslayouttherootsubjects:kinematics,dynamics, robots, and the other deals with human-centered and
control, mechanisms, architecture, programming, rea- lifelikerobots.Totheuninitiatedobserver,thesechapters
soning, and sensing. These are the basic technological arewhat advancedroboticsisallabout.However, it is
buildingblocksforroboticsstudyanddevelopment. important to realize that many of these extraordinary
The second layer has four parts. The first of these accomplishmentswouldprobablynotexistwithoutthe
deals with robot structures; these are the arms, legs, previousdevelopmentsintroducedinthefirsttwolayers
hands,andotherpartsthatmostrobotsaremadeupof. ofthisHandbook.
At first blush, the hardware of legs, arms, and hands It is this intimate connection between theory and
maylookquitedifferentfromeachother,yettheyshare practice that has nurtured the growth of robotics and
a common set of attributes that allows them to all be becomeahallmarkofmodernrobotics.Thesetwocom-
treatedwiththesame,orcloselyrelated,aspectsofthe plementaryaspectshavebeenasourceofgreatpersonal
fundamentalsdescribedinthefirstlayer. satisfaction to those of us who have had the opportu-
The second part of this layer deals with sensing nityto bothresearch anddevelop roboticdevices. The
and perception, which are basic abilities any truly au- contents of this Handbook admirably reflect this com-
tonomousroboticsystemmusthave.Aswaspointedout plementary aspect of the subject, and present a very
earlier,inpractice,manyso-calledroboticdeviceshave useful bringing together of the vast accomplishments
little of these abilities, but clearly the more advanced which have taken place in the last 50years. Certainly,
robotscannotexistwithoutthem,andthetrendisvery thecontents ofthis Handbookwillserve as avaluable
muchtowardincorporatingsuchcapabilitiesintorobotic toolandguidetothosewhowillproducetheevenmore
devices.Thethirdpartofthislayertreatsthesubjectar- capableanddiversenextgenerationsofroboticdevices.
easassociatedwiththetechnologyofmanipulationand The editors and authors have my congratulations and
theinterfacingofdevices.Thefourthpartofthislayer admiration.
ismadeupofeightchaptersthattreatmobilerobotsand
variousformsofdistributedrobotics. Stanford,August2007 BernardRoth
X
Foreword
To open this Handbook and un- rationality machines, expanding on the 1980s third-
foldtherichnessofits64chapters, generationrobotdefinition:
we here attempt a brief personal
“(robot) ... operating in the three-dimensional
overviewtosketchtheevolutionof
worldasamachineendowedwiththecapacitytointer-
robotics in its many aspects, con-
pretandtoreasonaboutataskandaboutitsexecution,
cepts,trends,andcentralissues.
byintelligentlyrelatingperceptiontoaction.”
The modern story of Robotics
beganabouthalfacenturyagowith Thefieldofautonomousrobots,awidelyrecognized
developments in two different di- test-bed, has recently benefited from salient contribu-
rections. tionsinrobotplanningusingtheresultsofalgorithmic
First, let us acknowledge the geometryaswellasofastochasticframeworkapproach
GeorgesGiralt domain of mechanical arms, rang- appliedbothtoenvironmentalmodelingandrobotlocal-
EmeritusResearchDirector ing from teleoperated tasks on izationproblems(SLAM,simultaneouslocalizationand
LAAS-CNRSToulouse
radiation-contaminatedproductsto modeling), and further from the development of deci-
industrial arms, with the landmark sionalproceduresviaBayesianestimationanddecision
machine UNIMATE – standing for uni(versal)mate. approaches.
Theindustrialdevelopmentofproducts,mostlyaround For the last decade of the millennium, robotics
the six-degree-of-freedom serial links paradigm and largelydealtwiththeintelligentrobotparadigm,blend-
active research and development, associating mechan- ing together robots and machine-intelligence generic
ical engineering to the control specialism, was the researchwithinthemescoveringadvancedsensingand
main driving force here. Of particular note nowa- perception, task reasoning and planning, operational
days is the successfully pursued effort to design and decisional autonomy, functional integration archi-
novel application-optimized structures, using power- tectures, intelligent human–machine interfaces, safety,
ful sophisticated mathematical tools. In a similar anddependability.
way, an important issue concerns the design and The second branch, for years referred to as non-
the actual building of arms and hands in the con- manufacturing robotics, concerns a wide spectrum of
textofhuman-friendlyrobotsfortomorrow’scognitive research-driven real-world cases pertaining to field,
robot. service,assistive,and,later,personalrobotics.Here,ma-
Second, and less well recognized, we should ac- chine intelligence is, in its various themes, the central
knowledge the stream of work concerned with themes researchdirection,enablingtherobottoact:
inartificialintelligence.Alandmarkprojectinthisarea
1. asahumansurrogate,inparticularforintervention
wasthemobilerobotShakeydevelopedatStanfordIn-
tasksinremoteand/orhostileenvironments
ternational. This work, which aimed to bring together
2. in close interaction with humans and operating
computer science, artificial intelligence, and applied
in human environments in all applications encom-
mathematicstodevelopintelligentmachines,remained
passedbyhuman-friendlyrobotics,alsoreferredto
asecondaryareaforquitesometime.Duringthe1980s,
ashuman-centeredrobotics
buildingstrengthfrommanystudycasesencompassing
3. intightsynergywiththeuser,expandingfromme-
aspectacularspectrumrangingfromroversforextreme
chanicalexoskeletonassistance,surgery,healthcare,
environments (planet exploration, Antarctica, etc.), to
andrehabilitationintohumanaugmentation.
servicerobots(hospitals,museumguides,etc.),abroad
research domain arose in which machines could claim Consequently,attheturnofthemillennium,robotics
thestatusofintelligentrobots. appears as a broad spectrum of research themes
Henceroboticsresearchescouldbringtogetherthese both supporting market products for well-engineered
two different branches, with intelligent robots cate- industrial workplaces, and a large number of domain-
gorized in a solely computational way as bounded orientedapplicationcasesoperatinginhazardousand/or