Table Of ContentSacrificial bonds and hidden length in biomaterials – a kinetic, constitutive
description of strength and toughness in bone
Charles K. C. Lieou,1 Ahmed E. Elbanna,1,2 and Jean M. Carlson1
1Department of Physics, University of California, Santa Barbara, CA 93106, USA
2Department of Civil and Environmental Engineering,
University of Illinois, Urbana-Champaign, IL 61801, USA
(Dated: January 28, 2013)
Sacrificial bonds and hidden length in structural molecules account for the greatly increased
fracture toughness of biological materials compared to synthetic materials without such structural
features, by providing a molecular-scale mechanism for energy dissipation. One example is in the
polymeric glue connection between collagen fibrils in animal bone. In this paper, we propose a
3 simplekineticmodelthatdescribesthebreakageofsacrificialbondsandthereleaseofhiddenlength,
1 based on Bell’s theory. We postulate a master equation governing the rates of bond breakage and
0 formation. Thisenablesustopredictthemechanicalbehaviorofaquasi-one-dimensionalensemble
2 ofpolymersatdifferentstretchingrates. Wefindthatboththerupturepeakheightsandmaximum
stretching distance increase with the stretching rate. In addition, our theory naturally permits the
n
possibility of self-healing in such biological structures.
a
J
5
I. INTRODUCTION locity. In particular, Bell’s theory [15] implies that the
2
maximum force that a molecule can sustain varies as the
] Many biological, polymeric materials gain their logarithm of the pulling speed, as is observed in experi-
t ments[16]. Ourearliermodel,however,doesnotaccount
f strength and toughness through the formation of sacrifi-
o for this rate dependence unless we impose the assump-
s cialbondsandhiddenlength. Examplesincludebone[1– tion that the “random bond strength” distribution itself
. 7], abalone shells [1, 8, 9] and diatoms [10–13]. Often,
t varies as the logarithm of the pulling velocity. Neither
a sacrificial bonds connect two different sites on a molec-
m doesourpreviousmodelentailarecuperationofstrength
ular backbone, thereby constraining part of the poly-
and toughness observed in experiments [4].
- mer from stretching. These bonds are typically weaker
d Anunderstandingofthesevelocity-andrecoverytime-
thanthecovalentbondsonthemolecularbackbone;they
n dependentbehaviorsisofparamountimportanceinmany
break and release “hidden length” before the molecular
o applications. For example, the propagation of cracks –
c backbone ruptures. This molecular-scale mechanism has
often caused by traumatic injuries in the case of bones –
[ been found to greatly increase the total amount of work
is a dynamical process (as opposed to quasi-static). On
needed to break the material.
1 the other hand, self-healing might impede the spread of
v An important example of sacrificial bonds and hidden microcracks in bone. To account analytically for these
8 length occurs in the polymeric glue connection between behaviors, we borrow the two-state model of protein un-
6 collagen fibrils in animal bone [1–7], illustrated schemat- folding due to Rief, Fernandez and Gaub [17]. Since
9
ically in Fig. 1. Each intact sacrificial bond shields part breakage of sacrificial bonds and protein unfolding both
5
. of the glue strand from contributing to its end-to-end involvetheforcedbreakageofnoncovalentbondsandthe
1 distance. Given an end-to-end distance, a glue strand unraveling of compact structure, we base our framework
0
of smaller apparent length carries less entropy than one on the assumption that the kinetics of sacrificial bond
3
1 with more available length. In other words, the pres- breakagecanbedescribedinasimilarmanner. Thetwo-
: ence of sacrificial bonds and hidden length amplifies the state model enables us to obtain analytic expressions for
v amountofforcethatisnecessarytostretchthepolymers, thetransitionrateintermsoftheforce-extensionprofile.
i
X andthereforeaccountsfortheincreaseinfracturetough- The rest of this paper is organized as follows. In
r ness of the material. Following breakage of one sacrifi- Sec.IIweusethetwo-statekineticmodeltoderivecondi-
a cialbond,thecorrespondinghiddenlengthnowunravels, tions for the breakage and formation of sacrificial bonds
causing a force drop as an immediate result of the spike and show how the pulling velocity relates to these pro-
in entropy. cesses. In Sec. III we apply the model to a single poly-
We recently proposed a theoretical model that ac- mer chain – a quasi-one-dimensional chain of entangled
counts for this mechanism and captures the mechanical polymer molecules in series. We show that the model
response of the stretched polymer network in the quasi- reproduces the logarithmic dependence of the peak force
static limit [14]. In that model, we assume that the on the pulling velocity and, with a judicious choice of
strength of sacrificial bonds is a random variable, pri- the several adjustable parameters, yields force-extension
marily to account for the apparent variability of bond profilesthatarequalitativelysimilartowhatisobserved
strengthasobservedinseveralstretchingexperiments[1– in collagen fibril separation experiments [1–5, 16]. In
5]. It is well known that the mechanical behavior of Sec. IV we apply the kinetic model to entangled poly-
stretchedbiologicalmoleculesdependsonthepullingve- mers and examine the effect of the delay time – the time
2
II. KINETIC MODEL
In this Section we introduce a kinetic model that de-
scribesthedynamicsofformationandbreakageofsacrifi-
cialbondsandreleaseofhiddenlengthinapolymernet-
work,andrelatethistomechanicalforcesonthepolymer
network. As a simplifying assumption, we propose that
the network of polymers – in the specific example of an-
imal bone, glue connection that hold the collagen fibrils
together – can be described as a quasi-one-dimensional
ensemble of polymer chains, regardless of whether sacri-
ficial bonds are found within a single polymer molecule
or between adjacent polymers. Each polymer chain may
consist of one long polymer molecule or multiple poly-
mers entangled together; see Fig. 1(a). The ensemble of
these quasi-one-dimensional chains thus acquires a dis-
tribution of total lengths.
In addition, we assume that each polymer chain is
semiflexible, so that the force-extension relation is given
by the wormlike-chain model [18, 19], in conformation
withmuchoftheliteratureonthemechanicsofproteins:
(cid:20) (cid:21)
k T x 1 1
F = B + − . (2.1)
b L 4(1−x/L)2 4
Here, the force F is entropic in nature, arising from the
FIG. 1: (Color online) Basic features of sacrificial bonds and tendency of the polymer chain to recoil and return to a
hidden length. (a) Hypothesized structure of polymeric glue stateofhigherentropyasitisstretched. InEq.(2.1),k
B
strands,withsacrificialbonds(bluecircles)alongthepolymer istheBoltzmannconstant,T isthetemperature,bisthe
chain backbone resisting chain rupture as they are stretched persistence length, x is the end-to-end distance, and L is
during microcracking. There are three types of sacrificial the contour length available for stretching – i.e. the to-
bonds: bonds within a polymer chain; bonds between dif-
tal contour length of each chain minus the hidden length
ferent chains; and bonds connecting the polymer chain to
shielded by sacrificial bonds. Breakage of each sacrificial
the substrate (collagen fibrils in the case of animal bone).
bond unveils hidden length, resulting in a step jump in
Adaptedfrom[4]. (b)Forcechangeassociatedwithsacrificial
the available contour length L. This results in an in-
bond breakage and hidden length release. (i) Before a sacri-
ficial bond is broken, only the black length of the molecule crease in the chain entropy which causes abrupt force
contributes to the entropic configurations and to the force drops. Stretching the chain without breaking sacrificial
with which the molecule resists stretching. The red length bonds reduces the entropy, thereby dissipating a signifi-
of the molecule is hidden from the force by the sacrificial cant amount of energy.
bond. (ii) When the bond breakage threshold is reached, the A sacrificial bond breaks when the force on the poly-
bondbreaksandthewholelengthofthepolymer(blackplus mer chain exceeds the strength of that bond. As men-
red) contributes to its configurational entropy. This sudden
tioned in the Introduction, we assumed in our previ-
increase in entropy leads to an abrupt force drop. (iii) As
ous work [14] that the bond strength is a uniform ran-
the polymer molecule is further stretched, the force it sup-
dom variable, reflecting the randomness of bond break-
ports increases, until the entire molecule detaches from the
age events. One approach to modeling the dependence
substrate and ruptures. The grey area represents the extra
of the mechanical behavior on pulling rate in the con-
work done in stretching a polymer with sacrificial bonds and
hidden lengths, relative to a polymer of the same length but text of the previous model would be to represent the
without such structural features. Reprinted with permission bond strength distribution itself directly as a function
from [14]. of pulling rate. However, this crude approach neglects
thefundamentalphysicsofratedependence. Meanwhile,
Bell’s model [15] expresses the transition probability of
bondformationandbreakageeventsasaBoltzmannfac-
torthatinvolvestheproductoftheforceandaparameter
that permits self-healing between two successive pulling withthedimensionsoflength,interpretedasthedistance
experiments – on the macroscopic mechanical response from the transition state of the conformational change.
of a pair of separating collagen fibrils. Based on these Alongwithothermoresophisticatedmodels(suchasthe
results, we propose in Sec. V a constitutive law that de- Kramer theory [20]), it has been successful in account-
scribes the macroscopic response of separating collagen ing for the rate dependence of forced protein unfolding,
fibrils. which in most cases involve breakage of weak internal
3
bonds. How, then, are we to apply such kinetic models where x and x are the chain end-to-end distances at
1 2
to the breakage of sacrificial bonds and release of hidden successive bond breakage events.
length? In mechanical experiments on stretched glue connec-
We proceed by assuming that the breakage of sacrifi- tion in animal bone [2–4] it has been found that sacri-
cial bonds follows a two-state pathway, so that we can ficial bonds mediated by ions such as calcium also form
apply Bell’s theory. At large forces and pulling rates, between the glue strand backbone and the collagen fib-
the formation of sacrificial bonds can be neglected. Mo- rils. Breakage of these end bonds causes the detachment
tivated by Su and Purohit [21], we propose that the rate of the entire glue strand from one of the collagen fibrils,
of change of the number of sacrificial bonds N is given so that the stretching force on the glue strand imme-
b
by the first-order differential equation diately drops to zero. In addition, it has been found
that broken links may self-heal, in that some broken end
dN∗
b =−k N +k N . (2.2) bonds would be restored if, after a particular pulling ex-
dt f b b f
periment,theentiresampleisleftuntouchedfortimesas
N∗ is the continuous version of the integer N ; it repre- shortasafewseconds[4]. Weproposethatthebreakage
b b
sentsthenumberofsacrificialbondsatagiveninstantof andrestorationofendbondscanbedescribedwithinthe
time,averagedoveranensembleofmanypolymerchains. same theoretical framework. That is, the change in the
It will be thresholded below (see Eq. (2.5)) to isolate in- numberofendbondsN isgovernedbytherateequation
e
dividual bond breakage and formation events, and it co-
dN∗
incideswithN wheneveritisaninteger. N =N−2N e =−kendN +kend(1−N ). (2.8)
b f b dt f e b e
isthenumberoffreesites,withN =L/bbeingthenum-
ber of sites, or persistence lengths, in the polymer. k N∗, the continuous version of the integer N , varies be-
f e e
and k are the rates at which bond fragmentation and tweenzeroandunity;itcanbeinterpretedasthefraction
b
bond formation events occur; according to Bell’s theory, ofendbondsthathaveyettobreak. Noticethat(1−N )
e
they are given by appears because each glue strand either attaches to the
bone fibril, or does not anchor to it. kend and kend are
(cid:18)F∆x (cid:19) f b
k = α exp f ; (2.3) theratesofendbondbreakageandformation,necessarily
f 0 kBT different from kf and kb, given by
(cid:18) (cid:19)
F∆x
kb = β0exp − kBTb . (2.4) kfend = αeexp(cid:32)F∆kxTefnd(cid:33), (2.9)
B
F = F(x) is the force-extension relation given by
Eq. (2.1). ∆xf and ∆xb are the distances to the tran- kend = β exp(cid:18)−F∆xebnd(cid:19). (2.10)
sition state; α and β are, respectively, inverse time b e k T
0 0 B
scales which describe the rate at which bond breakage
As before, α and β are respectively the rates at which
and formation events occur at zero pulling force. We e e
end bonds break and form when no external force is
have mentioned in the Introduction that the physics of
present, and ∆xend and ∆xend are the distances from
sacrificial bond breakage and protein unfolding are sim- f b
thetransitionstateforendbondbreakageandformation
ilar. Based on parameter estimates for the unfolding of
events. For a single polymer chain, the end bond breaks
proteins in [21], ∆x , ∆x and b are expected to be of
f b when
the order of 0.1 nm.
A bond breakage event occurs when N decreases by (cid:90) xc
b kend(F(x))dx=v (2.11)
unity – that is, when N∗ reaches an integer. Thus, the f
b 0
condition for a bond formation event to happen is
where x is the chain end-to-end distance at which the
c
(cid:90) (cid:90)
end bond breaks and the chain detaches.
dN∗ = (−k N +k N )dt=1 (2.5)
b f b b f We note on passing that for a collection of polymers
stacked in parallel, Eq. (2.8) should more properly be
wheretheintegralontherighthandsideisoverthetime
interpreted as the governing equation for the fraction of
betweensuccessivebondformationevents. Similarly,the
polymer chains with end bonds restored as a function of
condition for a bond breakage event to happen is
time t; thus,
(cid:90) (cid:90)
dNb∗ = (−kfNb+kbNf)dt=−1 (2.6) dNe∗ =−kendN∗+kend(1−N∗). (2.12)
dt f e b e
wheretheintegralontherighthandsideisoverthetime Suppose t = 0 marks the time at which all polymers
between successive bond breakage events. In particular, detachfromthesurface,afterthepreviousstretchingex-
for pulling experiments at constant velocity v, the pre- periment. Thenthe fraction N∗ ofpolymers thatadhere
e
ceding equation gives to the surface at time t is given by
(cid:90) x2 β (cid:104) (cid:105)
(kf(F(x))Nb−kb(F(x))Nf)dx=v, (2.7) Ne∗ = α +eβ 1−e−(αe+βe)t . (2.13)
x1 e e
4
Equations (2.7) and (2.11) can be used to predict the 0.30
force-extension curve of a stretched polymer; in partic- a
ular, they can predict the chain end-to-end distance at 0.25
which bond breakage events occur, as well as the corre- N 0.20(cid:68)(cid:72) (cid:76)
sponding bond strengths. Meanwhile, Eq. (2.13) is par- n (cid:64)
F
ticularly useful for analyzing the dependence of the me- 0.15
e
chanicalbehaviorofmultiplepolymersstackedinparallel rc
on the delay time between pulls. Fo 0.10
Note that while our model is deterministic and does 0.05
not capture the randomness of bond breakage events as
0.00
in [14], it represents an average over a large ensemble of
0 20 40 60 80 100
experiments.
Pullingdistancex nm
III. PULLING A SINGLE POLYMER CHAIN: (cid:64) (cid:68)
THEORETICAL PREDICTIONS
We begin by considering the force-extension behavior
of a single polymer chain whose total length is L =
c
100 nm. Let m denote the number of sacrificial bonds.
For simplicity, we assume that shielded lengths do not
contain sacrificial bonds, and that the length L of each
j
hiddenloopisauniformrandomnumberlessthanL /m.
c
Then the initial available length is L = L −(cid:80)m L .
i c j=1 j
To locate bond breakage events, we integrate Eq. (2.7)
overtheforce-extensionprofile,andcomputetheend-to-
end distance x at which each individual bond breakage
2
event occurs, assuming that bonds break in the order of
increasing shielded length. We integrate Eq. (2.11) over FIG. 2: (Color online) (a) Force-extension curves of a poly-
the entire force-extension curve to locate the maximum mer with a total contour length of L = 100 nm and with
c
pulling distance before the polymer chain detaches from m=6 sacrificial bonds, stretched at v =102 nm s−1 (blue),
the underlying material. 103 nm s−1 (red), and 104 nm s−1 (green), increasing from
Figure 2(a) show the force-extension curves of a poly- bottom to top. (b) Comparison between sample experimen-
tal pulling curves of a polymer chain with sacrificial bonds
merchainwithm=6sacrificialbonds, stretchedatfour
representativevelocitiesv =102,103 and104 nms−1. In andhiddenlength(uppergreycurve)andonewithout(lower
black curve). Adapted from [2]. In both figures, the shaded
computing these theoretical curves we have used the pa-
arearepresentstheextraenergydissipatedthroughsacrificial
rameterestimatesα =0.3s−1,β =0.003s−1,α =0.1
0 0 e bonds,ameasureoftheincreaseintoughnessofthematerial.
s−1, b = 0.1 nm, ∆x = 0.25 nm, ∆x = 0.1 nm, and
f b
∆x =0.15nm. Themagnitudesoftheseparametersare
e
roughlyconsistentwiththoseinproteinunfoldingmodels
(for example [21]). The average internal bond strength chain length, etc.) in different samples, the aim of this
variesfromroughly80pNatv =102nms−1to150pNat comparison with individual chain pulling experiments is
v =104 nms−1,whiletheendbondstrengthvariesfrom toseekqualitative,ratherthanexactquantitative,agree-
roughly150pNto300pNoverthesamerangeofpulling ment; qualitative agreement between the theoretical and
velocities. Forcomparison,Fig.2(b)showssampleexper- experimental results is clear.
imental pulling curves of a polymer chain with sacrificial Figure 3(a) shows the variation of the maximum
bonds and hidden length. The force drops due to break- stretch x as a function of the pulling velocity, for two
c
age of sacrificial bonds and release of hidden length are polymer chains with 6 and 12 sacrificial bonds respec-
alsoseeninthegreycurvehere,whichrepresentsthebe- tively but are otherwise identical; the overlap of the
havior of a typical polymer chain with sacrificial bonds, curvesindicatesthatthisisindependentofthenumberof
stretched by the tip of an atomic force microscope. The sacrificialbonds. Figure3(b)isalog-linearplotthatdis-
black curve shows the mechanical response of an oth- playsthevariationoftheendbondstrengthasafunction
erwise identical polymer chain, i.e., one with the same of the pulling velocity v. The linearity of the plot shows
total length but with no sacrificial bonds. In both fig- that the end bond strength, which equals the maximum
ures, the shaded area between the two curves represents stretching force along the stretching profile, varies loga-
theincreaseintoughnessduetothepresenceofsacrificial rithmicallywiththestretching velocityv, asispredicted
bondsandhiddenlength. Duetotheinherentvariability byBell’stheory[15]andseeninexperimentswithdentin
of experimental parameters (ion concentration in buffer, matrix protein 1 [16], shown here in Fig. 3(c).
5
m (cid:68) J 8 (cid:68)
enddistancen 7880 (cid:64)(cid:72)a(cid:76) (cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225) (cid:45)18sipation10 46 (cid:64)
(cid:45)(cid:45)to 76 (cid:231)(cid:225) (cid:231)(cid:225) ydis 2 v(cid:61)104nms
d g v(cid:61)103nms
en 74 (cid:231)(cid:225) ner v(cid:61)102nm(cid:144)s
um E 0 (cid:144)
m 72 0 5 10 15 20 25 (cid:144) 30
axi (cid:231)(cid:225) Numberof sacrificialbondsm
M 100 200 500 1000 2000 5000 1(cid:180)104
Pullingvelocityv nms
FIG.4: (Coloronline)Totalenergydissipationovertheentire
courseofstretching,asafunctionofthenumberofsacrificial
(cid:64) (cid:144) (cid:68) bondsm,forstretchingvelocitiesv=102 nms−1 (blue),103
akforcenN 000...223050(cid:64)(cid:68)(cid:72)b(cid:76) (cid:231)(cid:225) (cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225)(cid:231)(cid:225) ntisnoumdrFtieosci−gpaotu1.fer(Rteroheensde4eu)tl,sstotahsaunoangdwrdhe1asn0rae4dtvshensdremaeovgtfsieoa−tdtth1aioeo(lvngeper.renoe2leny0r)mg0,yiernurdcnrcisesh.asaisTpiinnhagetgifvoirvenoerm,tnicabbaoylmtbtteoahamres-
Pe (cid:231)(cid:225) area under the force-extension curve, as a function of
(cid:231)(cid:225)
the number of sacrificial bonds m, for three representa-
0.15 tive stretching velocities v = 102,103 and 104 nm s−1,
(cid:231)(cid:225)
100 200 500 1000 2000 5000 1(cid:180)104 and averaged over 200 runs. While sacrificial bonds and
hiddenlengthconstituteamajortougheningmechanism,
Pullingvelocityv nms
increasingthenumberofsacrificialbondsbeyondm≈15
fails to further stiffen the chain, as is found in [14]. In
(cid:64) (cid:144) (cid:68) addition, the importance of this toughening mechanism
becomes more pronounced at high pulling velocities (of
theorderof1000nms−1),providingincreasedresistance
against impact loading.
IV. STRETCHING MULTIPLE POLYMER
CHAINS IN PARALLEL; EFFECT OF DELAY
TIME BETWEEN PULLS
In this section we consider the dynamical behavior
of multiple polymers stretched in parallel. For simplic-
ity, assume that each polymer chain is independent of
the others, with no entanglement between the polymer
strands, so that the total force equals the sum of forces
FIG. 3: (Color online) (a) Maximum pulling distance, and in each polymer chain.
(b) end bond strength, as functions of pulling velocity v, for Figure 5 shows the force-extension curves of N =200
p
m = 6 (blue circles) and 12 (red squares) sacrificial bonds.
parallel polymer chains, at pulling velocity v =1000 nm
The overlap of the curves indicates that both quantities ap-
s−1, for delay times (the time between rupture of all end
peartobeindependentofm. Figure(c)isthedynamicforce
bondsandthestartofthenextpullingexperiment)rang-
spectrum of dentin matrix protein 1 with sacrificial bonds
ing from 1 to 20 seconds. In computing these theoretical
mediated by sodium, calcium and lanthanum buffers respec-
tively, adapted with permission from [16]. Our theory pre- curves we have used Eq. (2.13) to calculate the fraction
dicts a log-linear dependence, as observed in experiments, of of polymers with restored end bond connections to the
the end bond strength on the pulling rate. underlying substrate (for example, mineralized collagen
fibrils in the case of glue connection) as a function of the
delaytimet. WeassumethatthetotalcontourlengthL
c
of each polymer is uniformly and randomly distributed
between 50 and 150 nm. We use Eq. (2.5) to compute
6
3.5
a
3.0
t(cid:61)20s 3
N 2.5 (cid:68) t(cid:61)10s N (cid:72)(cid:68)(cid:76)
n 2.0 (cid:64) t(cid:61)5s n (cid:64)
F e
ce 1.5 t(cid:61)2s orc 2
or f
F 1.0 k
a
e
0.5 P 1
0.0
0 20 40 60 80 100 120 140
0
Pullingdistancex nm 0 5 10 15 20
Delaytimet s
FIG. 5: (Color online) Force-stretch(cid:64)cur(cid:68)ves for Np = 200
polymerchainsstackedinparallel. Thedelaytimesaret=2s 140
(cid:64) (cid:68)
(blue),5s(red),10s(green)and20s(orange)frombottomto b
top, corresponding N N∗ =8, 18, 28 and 36 polymer chains
p e 120
adhering to both pieces of substrate (collagen fibril) at the
beginning (see Eq. (2.13) for an expression for Ne∗). m (cid:68)(cid:72) (cid:76)
100
n
(cid:64)
h
c
et 80
the number of internal sacrificial bonds that form as a Str
function of the delay time, and assign random hidden
60
lengths to each of these sacrificial bonds as before. As
before, we have chosen α = 0.3 s−1, β = 0.003 s−1,
0 0
and α = 0.1 s−1. To account for the relatively slow re- 40
e 0 5 10 15 20
covery of ruptured polymer chains as a function of the
Delaytime s
delay time, as seen in [4], we choose β = 0.025 s−1.
e
These sample pulling curves indicate that the extension
atmaximumforceandthemaximumextensionatagiven FIG.6: (Coloronline)(a)Peakforce,a(cid:64)n(cid:68)d(b)displacementat
maximumforce(blue,bottomcurve)andmaximumextension
pulling velocity is independent of the delay time. Also,
(red, top curve), as functions of delay time, for N = 200
theforcepeaksleveloffforlargedelaytimes. Thisfollows p
polymers stacked in parallel, pulled at v = 1000 nm s−1.
from Eq. (2.13), which shows that the fraction of poly-
Resultsareaveragedover100runs,andtheerrorbarsindicate
merswithrestoredendbondconnectionsapproachesthe
one standard deviation.
asymptoticlimitβ /(α +β )asthedelaytimetbecomes
e e e
large;onlythosepolymerswithrestoredendbondscarry
thepullingforceandcontributetoenergydissipation. In dissipationbroughtbythesesacrificialstructures(seebe-
the limit αe (cid:28) βe, all end bonds are restored for large low), thereby delaying the occurrence of the maximum
delaytimesbetweensuccessivepullingexperiments. Our force.
present choice of parameters, however, stipulates that at Figure 7(a) shows the total energy dissipation, a mea-
most one-eighth of all glue strands are attached to bone sure of the toughness of the glue connection between
fibrils at both ends. the two pieces of underlying material, as a function of
To verify these claims, Fig. 6(a) shows the peak force the delay time t between pulls. For small delay times,
as a function of delay time t between pulls, for N =200 the marked growth in the number of restored end bond
p
parallel polymers pulled at a velocity v = 1000 nm s−1, connections, the number of restored internal sacrificial
averagedover100runs. Thepeakforceincreasesroughly bonds, and the increase in energy dissipation as a func-
in proportion to Ne∗ = (βe/(αe +βe))(1−e−(αe+βe)t), tionofthenumberofinternalsacrificialbonds(cf.Fig.4)
the fraction of polymers that possess restored end con- all contribute to the fast increase of total energy dissipa-
nections and therefore transmit the force. Figure 6(b) tion as a function of the delay time. For large delay
shows the displacement at maximum stretching force, as times, however, these growths slow down gradually, so
well as the maximum stretch, as a function of delay time that the increase in energy dissipation flattens out. A
between pulls. Both quantities are roughly independent comparison to Fig. 7(b), which shows the experimental
of the delay time, except that the displacement at max- measurements for the energy dissipation involved in the
imum stretching force shows a slight decrease for small separationoftwobonefibrils[4],indicatesthatourtheo-
delaytimes. Thiscanbetracedtothefactthatthesmall reticalpredictionqualitativelymatchestheexperimental
numberofinternalsacrificialbondsthatrestoreforsmall observations of bone fibrils in a buffer of calcium and
delays times leads to fewer cusps in the force-extension sodium ions. The result for a sodium buffer corresponds
curveofeachpolymerchainandreducestheextraenergy todifferentchoicesfortherateparametersk ,k ,α and
f b 0
7
F(x,v,t) for the force on the polymeric system under
(cid:68)a
J 200 stretch.
8
1
(cid:45)
0
1 150(cid:64)(cid:72) (cid:76) 0.12
n
o
pati 100 N 0.10(cid:68)
ssi n 0.08(cid:64)
di f
nergy 50 force 0.06
E 0 age 0.04
r
0 5 10 15 20 ve
A 0.02
Delaytimet s
0.00
0 20 40 60 80 100 120 140
(cid:64) (cid:68)
Pullingdistancex nm
FIG. 8: (Color online) Force per polymer chain that is at-
(cid:64) (cid:68)
tachedatbothendsatthebeginningoftheexperiments,asa
function of pulling distance, for N =200 polymers. Results
p
are averaged over 100 runs, thereby smoothing out abrupt
forcedrops. Thedelaytimesaret=5s(blue),10s(red)and
20 s (green). The pulling rates are v =100, 1000 and 10000
nm s−1 for the three sets of curves, from bottom to top.
Tothisend,Fig.8showssampleforce-extensioncurves
of N = 200 polymer chains stacked in parallel, normal-
p
ized by the number of chains that are attached at both
ends at the beginning, ignoring all interactions between
them, for delay times ranging between 1 and 10 seconds.
In computing these theoretical curves we have averaged
over 100 pulling experiments and divided the total force
FIG. 7: (Color online) (a) Total energy dissipation over the F(x,v,t) by the total number of polymer chains N N∗
p e
entire course of stretching, as a function of delay time, for that are attached to the collagen fibrils at both ends at
Ns−p1.=R2e0s0upltoslyamreerasvsetraacgkeeddoivnepra1r0a0llerlu,npsu,llaenddatthve=er1r0o0r0bnamrs tahsegbiveegninnbiyngE,qw.h(e2r.e13N).e∗ =As(βine/(Fαige.+5βet)h)e(1t−otea−l(αceo+nβtoe)utr)
indicate one standard deviation. (b) Figure 2(c) from [4], re-
length L of each polymer is uniformly distributed be-
c
produced here for comparison, shows the energy dissipation
tween 50 and 150 nm. Importantly, for each pulling ve-
involvedintheseparationofbonefibrils,inabufferwherecal-
locityv,thecurvesfordifferentdelaytimestcollapseto-
ciumandsodiumionsarepresent(red),andinabufferwhere
gether. This implies that in the limit of long delay times
only sodium ions are present (blue). The authors there con-
t, the total force in separating two pieces of collagen fib-
cludedthatcalciumionsleadtoenhancedbondstrength,and
withinourchoiceofparameters,ourtheoreticalpredictionfor ril is given as a function of distance x and separation
theenergydissipationqualitativelymatchesthatof[4]inthe velocity v by
presence of calcium ions.
F(x,v,t)=N N∗(t)f(x,v). (5.1)
p e
The delay time dependence comes in only through the
β , etc. fraction N∗(t) of polymer chains attached to the bone
0 e
fibrils at the beginning. The average force on each of
these polymer chains, f(x,v), is independent of the de-
V. TOWARDS A CONSTITUTIVE LAW FOR lay time t and can be approximated by separate power
FORCE AS A FUNCTION OF DISTANCE law fits to the increasing (strengthening) and decreasing
(weakening) portions of the curves:
In multiscale simulations of bone fracture it is neces- (cid:18) x (cid:19)s1
soafrcyoltloaginencofirpbroirlastuenadecrontsetnistiuletivsetrleasws.fMorotrheespseepcaifiracatilolyn, fp(v) xp(v) , if x≤xp(v);
in realistic situations where hundreds of glue strands are f(x,v)= f (v)(cid:18) xc(v)−x (cid:19)s2, if x (v)<x<x (v);
paremseenant-bfieetlwdeseennseeac(hi.ep.aisrmoofoctohlilnaggeonufitbarlills,abwreupnteefdo,rcine 0p, xc(v)−xp(v) if xp≥xc(v). c
drops due to bond breakage or detachment), a force law (5.2)
8
Here, f (v), x (v) and x (v) are the velocity-dependent catastrophic failure.
p p c
peak force, end-to-end distance at peak force, and max-
imum pulling distance, respectively. We find that s ≈ 1.0
1
1.35 and s ≈ 0.65 and, in the case v = 1000 nm s−1
2
s
shown in Fig. 8, that fp ≈ 0.094 nN, xp ≈ 43.5 nm and nd 0.8 f x,v
xc ≈115 nm. Figure 9 shows how this function fits sam- bo
ple force-displacement profiles. ntact 0.6 endb(cid:72)ond(cid:76) breakage
i
0.12 of 0.4
n
o
N 0.10(cid:68) xp acti 0.2
n (cid:64) Fr internalbondbreakage
0.08
f
ce 0.0
or 0.06 0 20 40 60 80 100 120 140
f
age 0.04 fp Pullingdistancex nm
r
e
v
A 0.02 x FIG. 10: (Color online) Number of polymer chains that have
c (cid:64) (cid:68)
yet to rupture, for N = 200 polymers stacked in parallel,
p
0.00 pulled at v = 1000 nm s−1, normalized by the number of
0 20 40 60 80 100 120 140
polymerchainsattachedtobonefibrilsatthebeginning(solid
Pullingdistancex nm curves); and fraction of internal sacrificial bonds that have
yet to rupture (dashed curves). The delay times are t = 2 s
FIG. 9: (Color online) Force-stretch curves as in Fig. 5 for (blue), 5 s (red), 10 s (green) and 20 s (orange). The black
(cid:64) (cid:68)
N = 200 polymers stacked in parallel, pulled at v = 1000 dot-dashed curve is a vertically rescaled f(x,v) and shows
p
nms−1,normalizedbythenumberofpolymerchainsthatare that the onset of polymer chain detachment coincides with
attachedatthebeginningoftheexperiment. Thedelaytimes the transitionto weakeningbehavior after reaching themax-
are t = 2 s (blue), 5 s (red), 10 s (green) and 20 s (orange). imum force fp. This illustrates the interplay between mi-
ThethickblackcurverepresentsthefittingfunctionEq.(5.2) croscopic physics (bond breakage) and macroscopic behavior
with parameter values given in the text. Note that the blue (displacement weakening).
curve for the short delay time t = 2 s is noticeably jagged,
owing to the fact that only 8 polymer chains (see Eq. (2.13)) To extract the velocity dependence of the quantities
adhere to the bone fibrils at the beginning. The quantities f (v), x (v) and x (v) explicitly, we plot these quanti-
p p c
f ,x andx appearinginEq.(5.2)arelabeledinthefigure.
p p c ties in Figs. 11(a) and 11(b). They can be fit with the
functional forms
The quantity x (v) marks the transition from a
p (cid:18) (cid:19)
v
strengthening to a weakening behavior, associated with f (v) = f log +f ; (5.3)
thegradualdetachmentofpolymerchains. Tocheckthis p 1 v0 0
assertion, the solid curves in Fig. 10 show the evolution (cid:18) v (cid:19)
x (v) = p log +p ; (5.4)
ofthefractionofinitiallyintactgluestrandsthatremain p 1 v 0
0
abtotnadchsebdeitnogthinetcaocltl)a,gaesnafibfurnilcstaiotnbootfhtheneddsis(pi.lea.cewmitehnetnxd, (cid:34) (cid:18) v (cid:19)2(cid:35) (cid:18) v (cid:19)
x (v) = c log +c log +c . (5.5)
at the same pulling velocity v = 1000 nm s−1. One sees c 2 v 1 v 0
0 0
immediatelythattheonsetofpolymerchaindetachment
coincides with the transition to weakening behavior at Withinourchoiceofsystemparameters,wefindv =100
0
x . In addition, under our assumption of a uniform dis- nm s−1, f = 0.064 nN, f = 0.013 nN, p = 41 nm,
p 0 1 0
tribution of polymer chain lengths, the number of poly- p = 1.3 nm, c = 104 nm, c = 6.3 nm and c = −0.57
1 0 1 2
mer chains that have yet to rupture decreases linearly nm.
with separation distance in the weakening regime. On We have thus shown that in the limit of long delay
the other hand, the dashed curves show that breakage times t, the total force F on the ensemble of polymers
of sacrificial bonds within individual polymer chains oc- can be factored into the product of the number N N∗(t)
p e
curscontinuallyinboththestrengtheningandweakening of polymer chains that are intact at the beginning of the
regimes. Figure 10 thus demonstrates how microscopic pulling experiment, times the average force f(x,v) per
physics (bond breakage), characterized by the state vari- polymer chain. Both the strengthening and weakening
ablesN andN ,accountsformacroscopicbehavior(dis- regimes – the latter being associated with the rupture of
b e
placement strengthening and subsequent weakening) in polymer chains and their detachment from the substrate
biological structures that contain sacrificial bonds and – can be described by power laws characterized by the
hidden length. In the context of dynamic fracture, the velocity-dependent peak force f (v), the displacement
p
strengtheningregimecorrespondstocrackarrestandthe at peak force x (v) and the maximum pulling distance
p
weakening regime corresponds to crack propagation and x (v). Among these, the peak force f varies linearly
c p
9
N and the number of chains N that adhere to the
b e
fnNp 0000....01119012(cid:64)(cid:68) (cid:72)a(cid:76) (cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231) sataofmohubrrvoeblceeddseltsiteoosrlipcitasniaalttaelesyctn-f–ehatdomreretocfhpeupteenehnintcFeocsdotnieinraolonyytnntnt–watwcohtrhfouwieitrctmieepthhr,hooieobllgyentpiochvmunuteelhdelnlariapnrtbbun-grysdleetltediaatnwtihtkesgeoaetr-rgamddkwenei,isocpnotaereeacmcsnncxcdluotciheekrransdeen.xt-idtncvihgTmaatanrhhteiindoees-
0.08 (cid:231)
(cid:231) amountofavailablecontourlengthL,thelatterofwhich
0.07 (cid:231) is computed in terms of the number of remaining sacrifi-
cial bonds N .
(cid:231) b
100 200 500 1000 2000 5000 1(cid:180)104 We have shown that sacrificial bonds and hidden
length lead to a marked increase in fracture toughness
Pullingvelocityv nms
in materials where they are present, and that both the
fracture toughness and maximum displacement before
(cid:64) (cid:144) (cid:68)
120 b (cid:225) (cid:225) (cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225)(cid:225) cthomeppuleltliengruvpetluorceityinvawphuilclhindgrievxepsetrhimeesnytstienmcraeawsaeysfwroitmh
(cid:225)
100(cid:225) equilibrium. Inparticular,thepeakforcefp intheforce-
(cid:72) (cid:76) displacement profile varies linearly with the logarithm of
m (cid:68)
thepullingvelocityv,inconformitywithvariousmechan-
n
xc 80(cid:64) ical experiments on biological molecules such as [16]. In
,p addition, our kinetic model naturally incorporates self-
x
healing, evidenced by the increase in the number of at-
60
tached polymer chains, rupture peak height and total
40(cid:231) (cid:231) (cid:231) (cid:231) (cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231)(cid:231) fornaec-tduirmeetnosuigohnnalesmsowditehl,rheocwoveevreyr,tidmoee.sOnoutresixmpplilceitqlyuaasci--
100 200 500 1000 2000 5000 1(cid:180)104
count for the effect of crosslinks and entanglements in a
Pullingvelocityv nms network of glue strands. The extent to which these ad-
ditional microscopic mechanisms will impact the macro-
FIG. 11: (Color online) (a) Plot of t(cid:64)he (cid:144)av(cid:68)erage peak force scopic behavior will be investigated in future work.
fp(v) per polymer chain as defined in Eq. (5.2) versus the Based on our theoretical calculations we have pro-
pulling speed v. The blue data points are average values posed a phenomenological description for the force-
from 100 runs and the red curve is the log-linear fit given
displacement profile of a collection of polymer chains
by Eq. (5.3). (b) Plots of the displacement at peak force
with a distribution of lengths. The force-displacement
x (v)(bluecircles)andmaximumpullingdistancex (v)(red
p c profile consists of a strengthening regime for small dis-
squares) as defined in Eq. (5.2) versus the pulling speed v.
placements, where the force increases with the displace-
Thedatapointsareaveragevaluesfrom100runs. Theblack
curves are the fits given by Eqs. (5.4) and (5.5). ment according to a power law. This is followed by a
weakening regime associated with the gradual detach-
ment of polymer chains which no longer contribute to
with the logarithm of the pulling velocity v, in confor- force transmission. Such a constitutive description will
mity with experiments. This constitutive approach en- be of utmost utility in future multiscale simulations of
ablesustodescribethemean-fielddynamicsofsacrificial bone fracture. The dynamical behavior of glue connec-
bond breakage and hidden length release using several tion between collagen fibrils has important implications
adjustableparameters,withouthavingtoaccountforthe oncrackpropagation,crackarrest,strengthrecuperation
random breakage of individual bonds in detail. and collagenous diseases in bone.
VI. CONCLUDING REMARKS Acknowledgments
In this paper we have developed a simple quasi-one- WethankPaulHansma,GeorgFantner,JamesLanger
dimensional kinetic model, based on Bell’s theory, that and Megan Valentine for instructive discussions and
describes the breakage of sacrificial bonds and release of comments. This work was supported by the David
hidden length in biological structures such as the link- and Lucile Packard Foundation, a UC Santa Barbara
age between collagen fibrils in animal bone. The kinetic Dean’s Fellowship, Office of Naval Research MURI
model draws ideas from theories of protein unfolding, a grants N000140810747, and the Institute for Collabora-
process that also involves the forced rupture of nonco- tive Biotechnologies through contract no. W911NF-09-
valent bonds and the exposure of folded structure. It 0001 from the U. S. Army Research Office. The content
tracks the evolution of the number of sacrificial bonds of the information does not necessarily reflect the po-
10
sition or the policy of the Government, and no official endorsement should be inferred.
[1] B. L. Smith et al., Nature 399, 761 (1999) [13] A. Sarkar, S. Caamano, and J. M. Fernandez, Biophys.
[2] G. Fantner et al., Biophys. J. 90, 1411 (2006) J. 92, L36 (2007)
[3] P. K. Hansma et al., J. Musculoskelet Neuronal Interact [14] A. E. Elbanna and J. M. Carlson, PLoS One, to appear.
5, 313-315 (2005) [15] G. I. Bell, Science 200, 618 (1978)
[4] G. E. Fantner et al., Nature Materials 4, 612 (2005) [16] J. Adams, G. E. Fantner, L. W. Fisher, and P. K.
[5] J. B. Thompson et al., Nature 414, 773 (2001) Hansma, Nanotechnology 19, 384008 (2008)
[6] M. E. Launey, M. J. Buehler, and R. O. Ritchie, Annu. [17] M. Rief, J. M. Fernandez, and H. E. Gaub, Phys. Rev.
Rev. Mater. Res. 40, 25 (2010) Lett 81, 4764 (1998)
[7] M. J. Buehler and S. Keten, Rev. Mod. Phys. 82, 1459 [18] C.Bustamante,J.F.Marko,E.D.Siggia,andS.Smith,
(2010) Science 265, 1599 (1994)
[8] J. D. Currey, Proc. R. Soc. Lond. B 196, 443 (1977) [19] J. F. Marko and E. D. Siggia, Macromolecules 28, 8759
[9] A.P.Jackson,J.F.V.Vincent,andR.M.Turner,Proc. (1995)
R. Soc. Lond. B 234, 415 (1988) [20] O. K. Dudko, G. Hummer, and A. Szabo, Phys. Rev.
[10] I. C. Gebeshuber et al., J. Microsc. 212, 292 (2003) Lett. 96, 108101 2006
[11] M. J. Higgins, S. A. Crawford, P. Mulvaney, and R. [21] T. Su and P. K. Purohit, Acta Biomater. 5, 1855 (2009)
Wetherbee, Protist 153, 25 (2003)
[12] T. M. Dudgale et al., Biophys. J. 89, 4252 (2005)