Table Of ContentUC Berkeley
Other Recent Work
Title
Risky Behavior Among Youths: Some Issues from Behavioral Economics
Permalink
https://escholarship.org/uc/item/5sf0z5rs
Authors
O'Donoghue, Ted
Rabin, Matthew
Publication Date
2000-06-07
eScholarship.org Powered by the California Digital Library
University of California
Risky Behavior Among Youths:
Some Issues from Behavioral Economics
TedO’Donoghue
DepartmentofEconomics
CornellUniversity
and
MatthewRabin
DepartmentofEconomics
UniversityofCalifornia,Berkeley
May3,2000
Abstract
This paper explores some of the ways that economists can incorporate insights from recent
research combining psychology and economics to help understand risky behavior by adoles-
cents.
Acknowledgments: We thank GeorgeLoewenstein andKen Train for useful conversations, andJon Gruberand participants in
theNBERprojecton‘‘RiskyBehaviorAmongYouths’’forusefulfeedback. Forfinancialsupport,wethanktheNationalScience
Foundation(Award9709485)andtheNBERprojecton‘‘RiskyBehaviorAmongYouths’’,andRabinthankstheRussellSage,Alfred
P.Sloan,andMacArthurFoundations.
Mail: TedO’Donoghue/DepartmentofEconomics/CornellUniversity/414UrisHall/Ithaca,NY14853-7601. MatthewRabin
/ Department of Economics / 549 Evans Hall #3880 / University of California, Berkeley / Berkeley, CA 94720-3880. Email:
[email protected] and [email protected]. CB handles: ‘‘golfboy’’ and ‘‘game boy’’. Web pages (with related papers):
http://www.people.cornell.edu/pages/edo1/andhttp://elsa.berkeley.edu/~rabin/index.html
1. Introduction
The goal of this volume is to provide an economic analysis of ‘‘risky behavior among youths’’,
looselydefined to bebehaviorby people under19that mighthave importantfuture ramifications.
Examples of such behaviors include smoking, drinking, unprotected sex, and crime. The tradi-
tionalapproachusedbyeconomistswouldseemtohaveimportantshortcomingsinthisrealm. The
rational-choice model provides a powerfultoolforunderstandingbehavior, andhas yielded an ar-
rayofinsightsacrossabroadrangeofhumanactivities. Butagrowingnumberofeconomistshave
come to recognize that the rational-choice model is inaccurate in some systematic and important
ways, and that to take full advantage of the economic insights and methodology economists must
embraceinsightsfrompsychologyandothersocialsciencessoastomakeourmodelsmorerelevant
andrealistic.
While the shortcomings of the rational-choice model are relevant for people of all ages, they
seem particularly acute for youths. In this chapter, we discuss how recent efforts combining psy-
chology and economics can be used to help understand risky behaviorby adolescents. We are not
(intheleast)experts inyouthfulriskybehavior,anddonotprovide averybroadperspectiveonall
the psychology relevant to this topic. Our goal here is less ambitious and more specific: We ex-
plorewhatsomeofthemaininsightsandissuesraisedbyrecentresearchinbehavioraleconomics
suggests about risky behavior by adolescents.1 Our focus is on the potential for applying formal
behavioral-economic models totheoretical andempiricalresearchon youthfulbehavior.
Whyshouldeconomistsbemotivatedtostudyriskybehavioramongyouths? Itcouldbethatwe
haveonlya‘‘positive’’interest—weareinterestedmerelybecausewe’dliketounderstandsociety
betterandestimateorpredictdrug use,criminalbehavior,suicides,andsoforth. For mostpeople,
however, the interest in youths’ behavior is motivated by ‘‘normative’’ considerations. Parents,
citizens,policymakers,andevenmanyeconomistsarenotmerelyinterested in predicting whether
16-year-olds startsmoking,use cocaine,getpregnant,orkill themselves,butin understandingthe
welfare consequences ofthesebehaviors.
One important normative question is whether risky behavior among youths creates negative
externalities on other members of society. Negative externalities are obviously an important facet
ofmany ofthebehaviorsstudiedinthisvolume,suchascrime,orbehaviors likealcoholanddrug
4 Forageneraloverviewofsomeofthetopicsstudiedbybehavioraleconomics,seeThaler(1992),Camerer(1995)
andRabin(1998).
1
use which can lead to crime and automobile accidents, or any behavior that leads to an increased
dependency on the state. Similarly, a major concern in preventing early pregnancy among girls
is the harm done to society (and to the children born). A reasonable guess is that youths have a
higherpreferencethanadultsforactivitiesthatcreatenegativeexternalities,sothatsocietymaybe
especiallykeen tocurtail theseactivitiesto the detrimentofyouths.
But clearly most of us are concerned about risky adolescent behavior in large part because we
believe adolescents are not even behaving in their own best interests, and because we feel that
somethingshouldbedonetohelp. Thisconcerniswarrantedbytheclearevidencethatevenadults
often do not behave in their own best interests. Of course, even if this concern motivates our re-
search,wecouldhelpstudysuicide,druguse,sex,andsoforthwithouttakinganexplicitstandon
whether these behaviors are good or bad, and then let policymakers and other audiences use our
behavioralconclusionstofurthertheirnormativeconcerns. Weintendthatthischapterhelpinthis
way. Webelieve,however,thatbehavioraleconomicsprovidessomevaluableinsightsintothepre-
cisenatureoftheharmyouths maycausethemselves,andhencehelpingpolicymakers understand
the connection between behavior and welfare may be the most central contribution of behavioral
economics. This will beourmainemphasis.
Our welfare emphasis may be controversial. Over the years economists have developed an ag-
gressive agnosticism with regard to welfare analysis for individual choice; refusing to make any
judgments that a person is not behaving in her own best interest. Caution is of course warranted,
because moreoftenthannotpeopleprobablyhaveabetterideaofwhat’sintheirownbestinterest
than do economists, other social scientists, and policymakers. But this caution has largely trans-
formed itself into an a priori presumption that people always behave in their own best interest.
Therearesome realms where commonsense,compassion,andintellectualcuriosityalltellusthat
weshouldconsiderthepossibilitythatpeoplemaynotbebehavingintheirownbestinterest. Risky
behaviorbyyouths is oneofthose realms.2
Of course, we should not replace welfare agnosticism with a ‘‘promiscuous paternalism’’ that
provides undisciplined assertions that others’ behaviors are not good for them, and that we know
betterwhattheyshoulddo. Rather,weneedaprincipledwaytostudywhenandhowpeoplemake
5 Related to our focus on welfare, we shall not devote this essay to proving beyond (an economist’s) doubt that
behaviorpredictedoutsidetherational-choiceframeworkisfundamentallyinconsistentwithrationalchoice. Wedoubt
thegeneralusefulnessofthewidespreadmethodologyofemployingposthoc attemptstofitbehaviorintotherational-
choiceframeworkwithoutanyinquiryastowhetheritisthecorrect explanation. Inmakingwelfareassessments,this
approachisclearlyinappropriate.
2
errors, what types of interventions might help mitigate these errors, and when we can have some
confidencethattheseinterventionshelpmorethanharm. Whenconsideringriskybehavioramong
youths,itisimportanttoavoidbothopinionatedmoralismastowhatistherightbehaviorandnaive
faith that 16-year-olds make no predictable mistakes in their choices. By identifying systematic
patterns inerrors thatpeople make,behavioraleconomics provides justsuch anapproach.
The development of behavioral economics has not been targeted at analyzing the behavior of
adolescents. The literature has developed with a belief that people make errors at all ages. It is,
indeed, worth stressing the similarities in the mistakes made at different ages. A 50-year-old may
sacrifice too much for sexual gratification just as a 15-year-old may, or a 36-year-old may drive
too soon after drinking just as a 16-year-old may. Errors associated in the common imagination
withone’s youth oftenlasta lifetime,and baddecisions attributedtoyouthmaynotbe as strongly
associatedwithageasis often claimed.3
That said, there are likely broad differences between adolescents and adults in many of the
realms we discuss. Young people almost surely make more mistakes. In Section 2, we briefly
discusspsychologicalevidenceonhowyouthsmakedecisionsandhowtheydifferfromadults. As
we proceed, we shall relate some of our theoretical analysis back to this evidence, but more often
speculate on how some of the obvious but little researched differences between youths and adults
relate tothebehavioralphenomena weconsider.
Beforeproceedingtothisevidence,however,webrieflyoutlinetheothersectionsofthischapter.
Wefocusonthreetypesofquestionsthatcanallbeusefullythoughtofintermsoftheirrelationship
to a rational-choice base model. Throughout the chapter we shall assume that a person’s overall
well-beingisdeterminedbyaddinguphiswell-beingateachmoment. Werefertoaperson’swell-
being in period | as his instantaneous utility in period |, which we denote by (cid:4) . To allow for
|
the possibility that the person’s instantaneous utility in period | is stochastic, let 7 be the set of
|
possible states for period |, and for r 5 7| let R|E(cid:4)cr(cid:28) and (cid:4)|E(cid:4)cr(cid:28) be the probability of state r and
instantaneousutilityfunctioninstater,respectively. Theperson’sexpectedinstantaneousutilityin
(cid:4) (cid:4)
period|isthereforeSrM7|R|E cr(cid:28)(cid:4)|E cr(cid:28). Finally,weassumetheperson’soverallwell-beingfrom
6 Thisinterpretationhasbeenendorsedbysomeoftheleadingpoliticalfiguresofourday. Asmanyofthoseattacking
Bill Clinton for lying about his extramarital affair were exposed for their own behavior, it became something of a
catchphrasetochalkupbadbehavioratvirtuallyanyageto‘‘youthfulindiscretion’’. Thisis,forinstance,preciselythe
termthat74-year-oldCongressmanHenryHydeusedtodescribetheextramaritalaffairhehadatage41.
3
theperspectiveofperiod|,which wedenoteby ‘|, is given by
A
‘| ’ R(cid:12)E(cid:4)cr(cid:28)(cid:4)(cid:12)E(cid:4)cr(cid:28) .
(cid:12)’| #rM7(cid:12) $
[ [
Section3is devotedtodiscounting. Thereaderwillnoticethatourbasemodelassumesnodis-
counting: The expected instantaneous utilities for all periods are weighted equally. We begin our
discussionin Section 3 by arguing thatfrom a normative perspective thereshould be no discount-
ing. Just because an adolescent cares very little for her 35-year-old self, it does not follow that
we should care very little for her 35-year-old self. We then discuss some recent approaches that
formalize the ways inwhich people underweight the future consequences of their actions,and the
lessons such approaches have foryouthful behavior. We discuss excessive myopia per se — pure
underweighting of the future — and the tendency to have a time-inconsistent preference for im-
mediate gratification—pursuingimmediate gratificationonamoment-by-momentbasisinaway
thatdoes not match a person’s ownlong-runpreferences. We alsodiscuss thecloselyrelatederror
of over-optimism about future self-control problems, which implies an under-estimate of future
misbehavior.
Section4discusseswaysinwhichpeoplemightmispredictfutureinstantaneousutilities. Hence,
whileSection3exploreswaysthatpeoplemightpaytoolittleattentiontothefutureconsequences
of their actions, Section 4 explores ways that people mispredict how they will feel in the future
aboutthoseconsequences. Wedescribesomesystematicwaysinwhichyouthsmayunder-estimate
the future harm caused by their current behavior because they do not fully recognize the extent of
day-to-day fluctuations in tastes, or the extent to which peer pressure will temporarily influence
their preferences, or just how much their preferences when older will differ from their youthful
preferences.
In Section 5, we discuss some issues with respect to the probability function R , focusing on
(cid:12)
the logic of repeated risky choices. Since either past or future risky behavior may change the
consequences of current risky behavior — in particular behaving in a risky way at other times
may affect the marginal risk accrued by behaving in a risky way now — certain types of risky
behavior can be understood only in an intertemporal context. We flesh out the logic of repeated
risky choices largely in a rational-choice setting, but then explore how those implications might
differ when people make errors in assessing risks, have self-control problems, or mispredict their
ownfuture preferences.
4
WeconcludeinSection6withamoregeneraldiscussionoftheissuesraisedandlessonslearned
fromthe analysis inthis chapter.
2. Evidence on Adolescent Decision-Making
In this section, we briefly review some evidence from psychology and related fields concerning
howyouthsmake decisions,andhowthey differfromadults.
Theparadigmofpsychologicalresearchmostcloselyrelatedtotheeconomicapproachisbehav-
ioral decision theory, which examines people’s actual decision-making processes, and how these
compare to ‘‘normative’’ (Bayesian) decision-making. Behavioral decision theory often breaks
down decision making into a sequence of steps, so that performance on individual steps can be
analyzed in isolation. There are extensive literatures that identify weaknesses in the ways adults
performthese steps.4
Thereisasmallerliteraturethatattemptstoanalyzethedecision-makingperformanceofadoles-
centsandhowadolescentsdifferfromadults. Thegeneralthemesinthisliteratureseemtobethat(i)
there is ratherlittle evidence,particularlyevidencewhichmakesdirectcomparisonsbetween ado-
lescents and adults, (ii) much of the evidence is, as assessed by researchers whose analysis most
resemblestheperspectiveofeconomists,weakduetomethodologicalproblems,and(iii)whatlittle
evidencethereissuggestsafewdifferencesbetweenadolescentsandadults,butonthewholethey
are remarkably similar. Indeed, a review article by Furby and Beyth-Marom (1992) emphasizes
thatmanycommonconceptionsforhowyouthsdifferfromadultsdoes notseemtobebornoutby
theevidence.5
Many studies have subjects formulate lists of potential consequences from various behaviors.
Beyth-Marom, Austin, Fischhoff, Palmgren, and Quadrel (1993) is one of the few studies that
directly compares adolescents and adults. Teens and parents were asked to generate possible con-
sequences fromseveral decisions (e.g.,you were [yourchildwas]at a party where marijuana was
passed around and decided to smoke). Although there were a few differences — for instance, on
averageadults generatedslightlymoreconsequences,andadolescentswereslightlymorelikelyto
mention consequences involving social reactions — overall the most striking conclusion was the
7 See,forinstance,Camerer(1995)andFischhoff(1988).
8 SeealsoFischhoff(1992)andBeyth-MaromandFischhoff(1997)forreviewsinthisvein.
5
similaritybetweenadults andadolescents.
Some list-the-consequences studies focus on the question of how future-oriented youths are.
Lewis (1981) conducted a study which compares adolescents in three grade categories (7-8, 10,
and 12). In simulated peer-counseling sessions, subjects were presented hypothetical dilemmas
and asked what advice they would give to a peer who faced these dilemmas. One of the main
results was a significant increase with grade level in the mention of the potential risks and future
consequences ofdecisions,whichsupportsthehypotheses thatthereis anincreaseinfutureorien-
tationthroughadolescence.6 FurtherevidenceofthisisreviewedinGreene(1986),whoconcludes
that‘‘...adolescents,ascomparedtoyoungerchildren: (1)demonstrategreaterdepthandextension
of temporal perspective...; (2) project a more complex differentiated set of future expectations...;
and(3)describefuture aspirations with greaterplanfulness,organization,andrealism....’’7
There have been comparisons between adolescents and adults not only in awareness of conse-
quences, but also in perceptions of the likelihood of those consequences. Quadrel, Fischhoff, and
Davis(1993)testtheconventionalwisdomthatyouthsarepronetohavefeelingsofinvulnerability
byaskingsubjectstoassessthelikelihoodthatvariousnegativeeventswouldoccurtothemselves,
an acquaintance, a close friend, and their parent or child. Subjects typically assessed similar like-
lihoods to themselves and to others. There was some evidence for feelings of invulnerability —
conditional on assessing different likelihoods, subjects were twice as likely to assess lower likeli-
hoodsforthemselves —butthis invulnerability was not strongerforadolescents thanforadults.8
In fact, there is evidence that youths are in some ways overly pessimistic about their future.
Fischhoff, Parker, Bruine de Bruin, Downs, Palmgren, Dawes and Manski (2000) survey youths
about personal probabilities of dying young. For a representative sample of 15 and 16 year olds,
the mean response to how likely it is that they would die in the next year was 18.6%, whereas the
statistical estimate is 0.08%. The mean response to how likely it is that they would die by age 20
was 20.3%,whereas thestatistical estimate is0.4%.
Researchershavealsoaskedwhetheradolescentsarecompetent decisionmakers. Forinstance,
WeithornandCampbell(1982)presentedadolescentswithhypotheticalmedicalandpsychological
9 Acontraryresult,however,wasthatthereseemedtobenodifferenceacrossgradelevelsinrecommendationsasto
whetherpeersorparentsshouldbeconsultedforadvice.
: GreeneconductsanexperimenttodetermineifsuchchangesarecorrelatedwiththeemergenceofPiaget’sformal-
operationsreasoning,andfindsatbestveryweakevidence.
; Infact,theinvulnerabilitywasstrongeramongadultsthanadolescents,butthisseemedmerelytoreflecttheplau-
sibleconsensusamongyouthsandadultsthattheadultswere lessvulnerabletomanyoftherisksunderconsideration.
6
treatment decisions, and found that 14-year-olds scored as well as 18-year-olds and 21-year-olds
incompetency,andLewis(1987)concludesthatintermsofpregnancyandcontraceptivedecisions
adolescents mayequaladults in theircompetence to reasonaboutdecisions.
Whilethestudiesaboveexaminehypotheticaldecisions,anotherliteratureexamineshowadoles-
cents’ perceptions of consequences, likelihood ofconsequences, and importance of consequences
predict their own behavior. For instance, Bauman (1980) presented 7th graders with 54 potential
consequences that might occur if they used marijuana, and asked them to rate on a 5-point scale
boththe likelihood and importance ofthose consequences to themselves. These ratings were then
foundtobepredictiveofself-reportedmarijuanausebythesameindividualsoneyearlater. Asim-
ilar technique has been used by a variety of researchers to study cigarette smoking, drinking, and
sexual intercourse. Furby and Beyth-Marom (1992) summarize (and criticize) these studies and
conclude that, ‘‘In sum, what little evidence there is (with all its mentioned weaknesses) suggests
that to at least some small extent teens choose to engage in behaviors which are more likely to
bring consequences they perceive as positive and less likely to bring consequences they perceive
as negative.’’
Many of the studies in this volume also support this conclusion. For instance,Gruberand Zin-
man find that youth smoking depends negatively on price, at least for older teens; Chaloupka,
Farrelly, Grossman, Johnston, O’Malley, and Pacula find that youth marijuana use depends nega-
tively on both price and the perceived risk of future harm; and Levine finds that teenage women
are less likelyto have sex and more likely to use contraceptives when labor market conditions are
good and when the perceived risk of HIV is high. These findings that adolescents react to costs
andbenefitssuggestthatyouthsaretosomedegreerationalinpursuingtheirwell-being. Butsince
all behavioral-economics models with which we are familiar assume people respond to costs and
benefits,suchfindings saynothing aboutthe validity ofthe extreme rational-choicemodel.
The evidence above suggests that adolescents are similar to adults in terms of their ability to
carryoutthedecision-makingprocess. Youthsseemtodiffermorefromadultsinhowtheyvaluethe
consequences of decisions. In fact, research in developmental psychology that studies adolescent
behavior focuses not on the decision-making process, but rather on what considerations matter
most to adolescents. Much of this research focuses on adolescent concerns with such things as
identity formation, sexual identity formation, and establishing autonomy and independence. The
researchsuggeststhatyouths maymakedecisionsbasedprimarilyontheseconsiderations andnot
7
‘‘objective’’ consequences. For instance, an adolescent male may drive fast so as to confirm his
masculine identity,virtually ignoring the potential negative consequences. Baumrind (1987) even
argues that many risk-taking behaviors by adolescents play an integral role in identity-formation
andmakingthetransitiontoadulthood.9
There are of course other reasons why youths and adults might value consequences differently.
Manystudiesovertheyearshavefoundyouthstendtoscorehigherthanadultsonsensation-seeking
andrisk-takingbehavior(Zuckerman,Eysenck,andEysenck(1978)andArnett(1994)). Andpre-
sumablyyouthsare moreconcernedthan adults with howtheirpeers willreacttotheirbehavior.
Differences in how youths and adults value consequences reflect differences in preferences,
whichinourmodelmeandifferencesintheinstantaneousutilityfunctions. Ifayoungmaleengages
in some risky behavior because it satisfies a need to confirm his masculine identity, or because it
yields desirable sensations, or because it will provoke positive reactions from his peers, it seems
naturaltoconcludethathehaspositivemarginalinstantaneousutilityfromengaginginthebehavior.
Ourtheoreticalanalysisbelowdoesnotfocusperse onhowadolescentpreferencesdifferfrom
adult preferences. Instead, we focus on the ways in which youths fail to behave in their own best
interests,andforthemostpartremainagnosticaboutwhatthosebestinterestsare. Butthefactthat
youthscarealotaboutthingssuchasidentityformation,sensationseeking,andpeerreactionsthat
tend to increase short-term benefits in a highly variable way may imply that the errors we discuss
are particularly problematic for youths, even if youths and adults do not differ in their inherent
propensity forthese errors.
The evidence on risk perceptions and differential preferences discussed above suggests some
waysinwhichouranalysisinSection4onmispredictingpreferencesandinSection5onrepeated
risky choices may be especially applicable to youths. While the evidence above comparing the
future orientation of adolescents vs. adults is relevant to our analysis of self-control problems
in Section 3, we discuss more direct evidence on the relationship between age and self-control
problems whenwe discuss evidenceonself-controlproblems more generally.
3. Trading Off Present vs. Future Consequences
Mostoftheriskybehaviorsaddressedinthisvolumeinvolveatrade-offbetweenshort-termbenefits
< Forrecentresearchbyeconomiststhatexplorestheroleofidentity,seeAkerlofandKranton(1999).
8
Description:Of course, we should not replace welfare agnosticism with a ''promiscuous paternalism'' that .. discount function often serves as a useful reduced form to capture unmodeled uncertainties such as In this formulation, B is the person's heuristic discount factor, capturing unmodeled uncertainties.