Table Of ContentRagamala Paintings: A Musicological Perspective*
ASHOK D. RANADE
Ragamala paintings inevitably attract an interdisciplinary examination. It
would notbe far-fetched to suggest that ragamala paintings, chitrakathis,
pabuji-ka-pad,and theyamapattakasorpatsfromPuri,etc.are representa
tiveIndianattempts to bringtogetherthe visualandaural modalitiesandtoevolve
artforms thatcombinemusic,painting,andliterature ordrama. Threecategories
ofarts-performing, fine, andliterary-joinforceshereandthesituationbecomes
challengingly complex. Ragamala paintings display a capacity to raise q'{estions
germaneto manyareas ofIndian studiessuchasiconography,literature, prosody,
mythology, and folklore. The present inquiry, however, draws on the three
music-relateddisciplinesof musicology,musicalaesthetics, andculturalmusicolo
gy. I do not claim that the approach registers a radical departure. The available
literature on ragamala paintings wouldclearly refute such a claim. For example,
ragamala paintings have been perceptively analyzed to tackle the musicological
problem of raga-classification. They have also been repeatedly discussedin the
a
contextoftherasatheory vis vismusic.Finally,therelevanceandcausationofthe
paintingshaveinterested many students of the broader cultural frameworkof this
country. In other words, the aim of my presentation can only be to assert a
continued relevance of the audio-visual experience that ragamalas impart.
Thequestionsthat the three disciplinesraiseare ofa kindthatdemand renewed
attention from each generation. Thisisinevitableas these disciplinesare directly
related to the performing tradition of music. For example, the musicological
questionshavea bearingon the technique andgrammarofmusic-making. On the
other hand, musicalaestheticsshoulders the responsibilityfor judgingthe quality
and value of the expenence involved. Cultural musicology regards music and
culture as mutual dependents and hence accepts the necessityof considering all
musicalevents afresh when cultural changes are perceived as such. In sum, the
scene is likely to remain exciting so far as ragamala paintings are concerned!
Experts agree that ragamala paintings, though barely 400 years old, have
musicological antecedents. The most notable has been the role allotted to the
human figure as an icon, as an active agent employed to concretize musical
speculations_In thiscontext the all-pervasivePurusbs conceptclaimsaconceptual
priority. Al itsmostabstractand metaphysicallevel,theconceptislinkedwiththe
act of creation. As Dr Kapila Vatsyayan has pointed out, "The Absolute
• ThisarticleisbasedonatalkfortheMohite-ParikhCentreforVISualArts.deliveredattheNational
Centre (or the Performing Arts. Bombay.
ScDgmN.WtNo. 103:January-March1992
4 ASHOK D. RANADE
Primordial (Purusha) gives rise to the individual archetype (purusha)", which is
instrumental in creating all the products of the bhutas-i.e. beings-through the
aid of sounds and words. The ancient sankhya philosophers held that Purusha is
witness to the creative activities of Prakriti. He is tata-stha while the stream of
creationflowson and by.A little more directisthe tradition ofcomparingmusicto
thehumanbody and statingequivalencesbetweenmusicalnotesand bodilyorgans,
etc. (e.g. sa=soul, re =head,ga=arms, ma =chest). Atyet anotherlevel, music
isunderstood asone limb of the larger conception of the arts seen as the Body of
Man with many interrelatedsystems. Finally,musicological texts openspeculations
on the science of music by describing the physical and biological foundations of
human life as a prelude to its more technical deliberations.
However, these comparatively abstract formulations are inadequate for the
visualization inherent in the act of painting. It is here that the very early Indian
customoffindingwide-rangingnon-musicalcorrelatestomusicalfeaturesmakesits
contributionfelt. For example, the correlatesfrom Bharata's Natyashastra can be
tabulated asshown inTable 1.TheNaradiya Shiksha moves a step forward inthat
swara is equated with varna (Table 2).
By the time we moveto amusical landmark, the Sangha Ratnakara,matters are
obviously heading towards firm visualization as well as personification processes
(Table3,p. 6). However, asGangolyperceptivelynoted, "eventhoughRatnakara
allots protective deities for melodies as distinct from individual swaras, their
pictures or images are not described...in any prayer-formulas in the shape of
descriptiveverses (dhyanas) suchaswefind inthe latertexts" (RagasandRaginis,
p. I06). Most authorities seem to agree that dhyanash/okasare not found priorto
the Ratnakara. According to Dr PremlataSharma, the Sangitopanishadsar(1350)
of Sudhakar, a Jain musicologist, is the earliest work to have dhyanash/okas.
(Incidentally,ChaitanyaDesai hassignificantly referredtoSudhakar'suse ofdance
terms traceable to Rajasthani languages and dialects.) Gangoly however gives
credit to the Panchama Sara Samhita of Narada, dated circa 1440, for the
appearance of both ragasand raginis and dhyanash/okas. More importantly, the
text of the dhyanash/okas-even in the later Sangitaraja of Kumbha, again from
Rajasthan (1433-68)-is to be marked for the resemblance ofthe dhyanas to the
tantric dhyanas. This ostensibly isthe reason why the following and similar terms
occur frequently in the early dhyanash/okas: pasha (lasso/noose), pha/am (fruit),
abjam (thousand-petalled lotus), japama/ika (rosary), veena (lute), padmam
(lotus), ankusha (goad), shankha (conch), chakram (wheel), gada (mace),
abhayakaram (a tantric mudra), etc. To anticipate a little, the dhyana concept
neededto be replacedbythenayaka-nayika bheda inpreparationfor theadventof
ragamalas.
Itisalso helpfulto note that dhyanash/okasare mostly relatedtogramaragasas
distinct from deshi ragas. The former kind belonged to margisangeet, i.e. sacred
music. On the otherhand, deshi ragasbelonged to deshi sangeeta which has been
succinctly defined in the Ratnakara as "the sangitacomprisinggitam, vadyam and
nrittam, that entertains people according to their tastes in different regions".
TABLE 1
Bharata's Correlatives
Rasa Shringara Hasya Karuna Roudra Vira Bhayanaka Bibhatsa Adbhuta
u.:
'" 'i'IR m>:I ""'" <fu: "'""" '""'" """"
Bhava Rati Hasya Shoka Krodha Utsaha Bhaya Jugupsa Vismaya
"'" <fu m>:I "Wi; "'" ~ "" ~ f<>l'l'I
Varna Shyama Sita Kapota Rakta Gsure Krishna Nila Pi:;.
-.uf l'l1'l fl!1I .,;rn «li >iR 'l"'I '"'" <1m
Lightgreen White Grey Red Yellow-red Black Blue Yellow
..
Devata Vishnu Pramatha Yarna Rudra Mahendra Kala Mahakala Brahma
~ f<lml """ "" 'lR "'" llm"'" "'"
TABLE 2
Correlatives in Naradiya Shiksha
Shadja Padmapatraprabha Brahmin
~ """"""
Lotus-petalred
Rishabha Shukapinjara Kshatriya
Wrq ~
Reddishyellow
Gandhar .K..a..n.a..kabha Half-Vaishya
'"""
Goldenred
Madhyama Kundasaprabha Brahmin
""'" ~
White
Panchama Krishna Brahmin
""" 'l"'I
Black
Dheivete ['jeaka Kshatriya
,j,.. ,;m;
Yellow
Nishada Servsveme Half-Vaishya
f.I'lIO: wl-.uf
All(multij-coloured
TABLE 3
Sharangdeva's Correlatives
Swara Shadja Rishabha Gandbara Madhyama Panchama Dhaivata Nishada
om
m ~ !ml 'li'lR ""'" """ Rom:
Varna Rskts Pinjara Swama Shubhra Krishna Pita VlChitra
'I"f "(if; lim 1'1"1 ~ 'l"'l '"" film
Alipil3
3!fu<itlI
Dcvets Vanhi Brahma Chandra Vishnu Narada Tumburu Tumburu
~ 'If.; ~ ~ f<l"l "'" lR' -iRi
Rasa Vira Vira Karuna Hasys Hasya Bibhatsa Karuna
'" '"' >ill ~ ~ ~ .r.,.,
Adbhuta Adbhuta Shringara Shringara Bhayanaka
"""" """" ~ !j>TR """'"'
Roudra Roudra
m:: m::
One may wonder about the actual link between the ragadhyanas and their
performance. Gangoly, Ebeling, and many others have suggested that the forms
were intended to be used byperformers in order to capture and comprehend the
divinequalitiesofmusicandthat theyare thusto bedescribed asprayer formulae.
Perhaps one should ponder a little over the concept of dhyana. The term is
derived from ,"', to meditate upon, imagine, call to mind. Dhyana is a mental
representation ofthe personal attributesof an image,traditionallyofa deity. The
concept has been developed by the Vedanta, Sankhya, Buddhist and Yogic
thinkers in their own ways. Dhyana has been inevitably linked to the divinity
concept interpreted according to the general thrust of the philosophy concerned.
The Yogicand, to someextent,the Buddhist interpretationiscomparativelymore
spiritual, psychological, and philosophical than theological. For example Patanjali
definesdhyanaas"""11<"~"'dH'" "IR1('. Without goinginto highlytechnicaldetails
the process could be described as the arrest of the march of those otherwise
evanescenl impressions received fromanythingselected asastimulus-support and
the consequent stabilization of a particular impression. Dhyanaconstitutes one of
theeightaspectsofPatanjali'syoga.Itcanbeessentiallycharacterizedasavictory
over time because dhyana denies successive moments their customary power of
destroyingthe experienceofallearlier momentsandthusbringingabout astateof
continuing instability. Ooe importantcomponentofthe procedure is3lR'P'R'I, i.e.
supportivestimulus.Itisthe mentalexercisepractisedbyyogisinordertostabilize
in the mind selected grosser forms of the eternal. Developed over the course of
centuries, dhyana proceduresandtechniques consistof two major types knownas
saguna and nirguna. The distinction between the two is that the latter involves
RAGAMALA PAINTINGS 7
concentration on abstract qualitieswhilethe former employsconcreteobjects etc.
A later Upanishad (Dhyanabindopanishad), devoted exclusively to the dhyana
phenomenon, significantly mentions Brahma, Vishnu, Rudra, Maheshwar and
Achyut as the main icons and the sounds of the Veena and Shankha as the
revelatorytimbres.The Buddhistsmadethe conceptsoaccomodativeasto include
ordinary objects as well as ashubhas (inauspicious things) as supportive stimuli.
I have dwelt on the dhyana concept at some length to suggest that the
ragadhyanas need to be understood as cumulative musicological and multi
channelled efforts to shift music away from the preemption of the sacred. The
dhyanaphilosophy, the psychological procedures involved in it, the techniquesit
perfected towards religio-metaphysical ends-all were skilfully assimilated and
adapted by medieval Indian musicology because music, music-makers, and
music-receiverswereundergoingatotal changeduringtheperiod.Oneofthe basic
principlesofcultural musicologyholdsmusictobethe mostreluctant culturalfacet
to accept change (and consequently the last to accept and exhibit change).
However, music isalso the mostsymptomaticofdeeperculturaltransformations.
Whenmusicchanges,everythingcanbeassumedtohavechanged.Theascendency
of the deshi element in the middle ages thus indicates comprehensive religious,
linguistic,demographic, political,and aestheticchanges that the Indian ethoswas
keentoassimilate. Asanaidintheprocess,non-representationalexpressionsuch
asmusicwouldneed representational strategicapplications,andragadhyanaswere
devised with this end in view. Sharangdeva in his Sangita Ratnakara spoke
perceptively of poorvaprasiddha and adhunaprasiddha ragas and thus drew
attention to noticeable changesdemandinga newsystematization. Itisinteresting
to note that though he reorganized the prevailing raga corpusby employing the
original-and-derived format, there is no indication of the ragini concept being in
vogue. Derivative ragas were not called rsginis.
Thus we reach the crucial span of the 16th-17th century, the period which
producedtwo major worksdirectlyrelated to ragamalas: KshemakarnaIMeshkar
na's Ragamala(1509)and Pundarik Vitthala's Ragamala(1576).The workslisted
raga-ragini-putra families, gave the descriptive verses, and followed them with
pictures. Obviously the raga corpus had grown enormously since the times of
Sangita Ratnakara. The concept of putra was therefore pressed into service to
accommodate the new entrants. Onee again the authors came from the
Rajastban-Malwa region. The accumulated influx of new ragas during the three
centuriesproved challenging to musicologists and musicians alike. Fortunately a
number of major musicologists appear to have been performers and this saved
themfrom beinginitiators ofdessicated theoreticalformulations. It issignificant to
note that Pundarik Vitthala not only includes as many as 16Persian ragasin his
familyof66but alsomentions their nearest Indianequivalents. Hedoesnot failto
clarifythatthe Persianragasareparada(giftedbyothers) butacceptsthemwithout
further ado!Pundarik Vitthala wasaSouthernerwhocame to theNorthinsearch
ofpatronage.He isreportedtohavewrittenonHindustanimusicand danceatthe
behestofhispatron.ThetwoworksofKshemakarnaandPundarikVitthalaarethe
acknowledged foundations of the ragama/as. However, discussion of the estab-
8 ASHOK D. RANADE
lishedragamalaconvention cannotbetakenupunlessaninterveningphaseistaken
into account.
The reference isto the Kalpasutra manuscripts dated late 15thcentury. Ebeling
admitsthat theKalpasutra Ragamalaisthe earliest, yetconcludes thatit is"a dead
end road interms ofpictorialragamala-s". Even ifone accepts hisjudgement,the
otherillustrationsfromthesameJainsourcemeritseriousnoticeforeverycultural
consideration. The manuscript illustrations deal with very fundamental musicolo
gicalconceptssuchasgrama, swara, shruti, murchhana andlana. Forthepresent
purpose some features of these 107 illustrations (described by the editor
alternatively as chitravaIi or sangita-rupavah) are worth noting:
1. All the illustrations have only one figure in the picture-space and the titleis
inscribed at the top.
2. Animals and birds finda place frequently but the commonformat isa figure
with a human body and an animal head.
3. The highlytechnical concepts depicted in the series closely followthe stated
musicologicaltradition. For example, the tana-visualizations include animalslbirds
because different tanas begin successively on different notes in sequence andthe
notes themselves have been associated with the calls of certain animals or birds
according to the musicological tradition.
4. It is surprising that even though the chitramala proceeds to include
illustrations on dance, the concept of tala is not even touched.
5. Altogether the series depicts 15musical instruments-none ofwhichsounds
an unfamiliar note!
The undiluted musicologicalorientationofthe seriesisremarkable. Ontheother
hand the Kalpasutra Ragamala includes ayudha (weapons), mudras, and other
visualforms that echo the Yaksha-Yakshini or Gandharva-Surasundari figuresof
temple sculpture.
According to ragamala experts the Kalpasutra effort is at least a century away
from the reallyimportantragamalas. As amusicologist1feel it represents amajor
step towards the mainstream ragamaJa tradition since it reflects the incipient
conceptual decision of the artiststo deny a one-to-one correspondence between
musicalandvisualphenomena.Thisiswhat made the laterragamalaspossible.The
Kalpasutra indicatesakindofbreakingaway,aliberation from aconventionwhich
was ambitiously comprehensive-attempting as it did to encompass too many
details and perhaps hamper the freedom of performance so essential to music.
Leaving aside this larger issue, it might be said that the Kalpasutra Ragamala,
though nearer to ragadhyanas than to the pictorial ragamalas that came later,
represents a necessary and a logical step towards them.
At thisstagealittlediversionneeds to bemade bygoingbacktothe ragadhyanas
and especiallytheir relation to the performing tradition. Is itsufficient todescnbe
the dhyanasasprayer formulae to express their link with the performing tradition
of Hindustani music? Perhaps in this respect the net has to be cast a little wider.
RAGAMALA PAINIlNGS 9
A look towards the Vaishnava tradition of musicin Assam and adjoining areas
seems advisable. This is logical because the ragamala traditions and Vaishnava
musicology both leaned heavily on the Sangita Damodara (1500 A.D.) of
Shubhankara. Authorities on Assamese and Manipuri music refer to the actual
singingofragadhyanasafter the initial alapawhichtoo isnot setto rhythm (Neog
and Changkakoty 1962, Darshana Jhaveri and Kalavati Devi 1978).In fact the
former twoauthorsassertthatraga-visualizationseemstohaveprevailedinAssam
from medievaltimesintheformknownasrege-mslits. Thesameauthoritiesstate
that Rama Saraswati, a contemporary of Shankaradeva (1449-1598), used the
expression raga-malita inhisGeeta Govinda anddescribed itasragadhyanawhile
he took the musical contents of his compositions from Shubhankara's Settgite
Damodara. Further, the authors drawattention tothe significantfactthat popular
raga-malitas differfrom the ragalakshanasofthe Sanskrit treatisesincludingthose
oftheSangita Dsmodsrs, Veryoften themalitasdonotgivepersonifiedpicturesof
ragasbutlinkthem withsomeincidentinthelifestoriesofKrishnaorVishnu.Both
these features suggestan independent, early, popular and secularevolutionofthe
eoncept ofragadhyana asa performance feature. The similaritybetween the two
termsragamalaandraga-malitaisalsoobvious.TheAssamesepracticecouldraise
many questions about the accepted statements on the origin, period, provenance
and raison d'etre of the ragamaJas as a musical phenomenon.
Yet another instance of regional variation of some significance is the Nasik
Ragamala brought to our notice by M.S. Mate and Usha Ranade in 1982.The
series is incomplete and consists of only 44 paintings. The set is based on
Kshemakarna's Ragamala and displays interesting similarities and deviations.
Dated 18thcentury, the seriesshowsaremarkablelocaltouch inthe physiognomy
of human figures, dresses, ornaments, general decor and architecturalsetting.
Even in the incomplete version, the inclusionof Jogi-Asavari in the raga corpus
mayprovesignificantinviewofthefactthatJogi-Asavari, likeGauri, iscommonin
the non-elite musical traditions of Maharashtra.
Maharashtra is also credited to have originated a series of pictures on talas
painted in the Deccan in the late 18thcentury. Whatever may be the verdict on
their pictorial worth, the paintings undoubtedly arouse musicological interest.
Inthemusicologicaltradition talahasneverbeenregarded aslessimportantthan
raga. A pictorial tradition fullyresponsive to the musicologicalcontinuity would
logically be expected to reflect the tala aspect of Indian music as well. It is
interesting to note that to the ancients tala was an action-reaction of the two
opposingprinciplesofpurushaandprakriti, ShivaandShakti. Almostpredictably,
ta has been equated with Shivaand la with Shakti. One might recall the tandava
dance of Shivaand the lasya expression of Parvati. Against this background the
Deccan attempt, however isolated and weak, needs to be appreciated as a
correction introduced to rectify the musico-pictorial imbalance conventionally
present in ragamala paintings. When one remembers that even the pioneering
Kalpasutra tradition did not touch tala (though it dealt with dance), the
contribution of the Deccan tala paintings assumes added value.
Usha Ranade and Kamal Chavan, the editors of the monograph on the tala
10 ASHOK D. RANADE
paintings, have argued Ihal talaisdifficultto portraybecause ofitssecondary role
ingenerating arasa.They have also rightly drawn attention to the fact that talais
distinct from layaand that it is the latter which is rightfully associated·withrasa.
Whether it is the early and seminal Vishnudhannottara Purana or the later
Sangitarajaof Kumbha, the emotive aspect of musicisclearly associated withlaya
ratherthan tala.But thisonlytakes the argumentfartherback!Thequestion which
could then be raised is: Whyisa pictorial representation of layanot found inthe
tradition? Perhaps the answer lieselsewhere and needs to sought after some more
ground has been covered.
Once again a look at North-eastern music-making may prove rewarding. It has
been recorded bystudents of Manipuri dance and musicand those of Vaishnavite
rhythmic expression in Assam that Pung and Khol arc played to realize musical
forms described as ragas. In the Manipuri presentation this specific form is
reportedly known as ahoubi.In a similar fashion the raga-diya (presentation ofa
raga) in the Assamese tradition includes raga-talaniwhich has no reference to the
tala/talas actually used in the performance of the Geet which follows later. The
raga-talaniinfactconsistsofplayingcertainpataksharasinadefinitesequence. Itis
thought-provokingthatthe oft-quoteddefinitionofraga-ranjayatiragah-hardly
makesthe exclusiveuseofmusicalnotes inevitable! Ifone considers the traditional
shabda-nada-dhvani-vamahierarchyitiseasyto followthe logicof havingragasof
the Mridanga or anyotherinstrument-with no mandatory rolefor musicalnotes.
The point is that ragamala paintings did not aim at reflecting the musicological
tradition-atleast not afterthe early dhyanaphase wasover. In fact,itdidnot use
musiceven as its stimulus!It became what it is because it worked within its own
pictorial tradition. The tradition, it appears to me now, is more theatre-oriented
than music-oriented. This is the reason whythe early Kalpasutra attempt withits
heavy musicologicalbias was not followed up.The twoother controlling contents
of the ragamalas are known to be the nayika-bhedadoctrine and the Krishna-lila
literature. It is necessary to remember that nayika-bhedaas propounded in the
Sanskrit traditionwaspart ofthe rasatheoryinwhichshringarawasdominant.The
Krishna-lila concept accepted the rasa system but processed it with allegorical
devotion through the literature of Jayadeva, Vidyapati, Surdas, etc. It is also
important to note that Rupa Goswami's UjjwalChintamanibrought into beinga
comprehensive bhakti-orientedVaishnava theoretical structure to add an invalu
able dimension to the Hindi literary tradition.
I suggestthat it isthe theatre-inspired rasa system which provided a foundation
forragamalapaintingswhilethe nayika-bhedaaspropoundedinthe Hinditradition
helped.to determine their content. The avatara concept has always proved
conducive to theatricexpression because it creates roles and not characters alone.
In addition, the Krishna-lila proved to be an apt formula for humanizing
abstractions inherent in conceptual structures in the rasa theory, literary
sophistications in the nayika-bheda, or philosophical subtleties in the avatara
concept. Itisagainst this background that wecan appreciate many components of
ragamala paintings: for example love as the sthayi-bhava; nayaka-nayika as the
alambana-vibhavas; friends/messengers and natural surroundings as uddipana·
RAGAMALA PAINTINGS 11
vibhayas; alankaras and hevss of the personages as anubhayas; and finally the
expressionsandfeelingsdepictedasthessncheti-bbsvss.Thisisthereasonwhythe
musicologicalauthenticitygetsweakerandweakeraswemovefromoneragamala
to theother. Meshakama and hisfollowersrepresent musicalimpulsestaken over
by theatric ideas struggling to give expression to artisticinterest in mundane (as
distinct from divine and profane), secular (as distinct from sacred), and
action-oriented (as distinct from contemplative) theme and content, In addition,
therewasthe urge toarticulateregionalinsteadofpan-Indianfeatures.Thus,while
the musical labels continued, the content underwent a radical change. The true
significance of the ragamala phenomenon would be lost if we continued to be
guided by the labels.
•
For a musicologist ragamala paintings could pose the following questions:
1. Why is it that there are no ta/ama/as?
2. Whyisit that the Camaticsystemofmusicdoes not enjoythisextra-musical
but music-related art expression?
3. Where did the basic loyalty of the ragamalas lie-in the performingor tile-
scholastic tradition of music?
4. Inviewofthe categorial pentad ofIndian musicalexpression,isitpreferable
to examine ragamala paintings with a set of criteria other than the customary
historico-rnusicological?
5. Indianmusicalexpressionhasbeenmorecompositethanusuallyrealized.Isit
possible to use the fact to explain the rationale governingthe origin, nature, and
function of the paintings?
6. What are the probable reasons which confined the ragamala tradition to a
certain part of the country? Were there any musical reasons for it?
7. Meshakama's attempt certainly provides the most complete model of the
paintings. But is it possible to ascribe deviations from his work to differences in
regionalmusicaltraditions? Inother words,pictorialdeviationsfrom Meshakama
may prove to be musical/musicological conformities. 0
Note:I wouldlike to dedicate this pre~ntalion to the late AtdhendukumarOaogopadhyay. beneT
knownas D.C Gangaly (l Aug. 1881-9Feb.1974).LikePandit V.N. Bhatkhanck (whom Gangaly
respected), Anfhendukumarleftaflourishinglegalpractice todevote bimsett to workin the fieldof
musicand arts. His insights into the visual artsand music made himamajorthinker analyzing the
composite nature ofIndian art theory and its practice. His book Ragas and Raginis laid a firm
foundationforthestudyofthe musicalaspectofragamalapaintings.ThefirstUmitededition ofRagas
andRaginisin 1935oorWstedofonlyJ6ropies. TIlt:secondedition saw theUghtofdayin 1947. He
dedicated this seminal work to Pandit Bhatkhande. Gangoly wn'tesbriefly but touchingly of how
Bhatlhande on his sid .bedshed silent rears when be found that the work wasdedicated to him.
Gangoly is thorough, fundamental, comprehensive, and systcfJliJtic. His work is at once an
encouragement and a challenge to students of Hindustani music - ADR.