Table Of ContentWho
Has Time
For Banking?
Let's face it. With so many demands on your busy schedule, you may
not have time to give your finances the attention they deserve.
That's where we can help. We're Professional & Executive Banking at
NationsBank. And while we can't turn your crammed daily calendar into
empty pages, we can take the hassle out ofbanking.
You'll work with one ofour experienced bankers, who will meet with
you at your convenience and personally assist you with your finances.
Whether your banking needs concern loans, savings orjust a checking
account, we'll help you decide what's right for you and put your plans
into action.
Discover the convenience of Professional & Executive Banking. Call
Mary Hill Gary at (706) 849-0667 or Jean P Daniel at (706) 729-9156.
Because while you may not have time for banking, we do.
NationsBank
NationsBankCorporationsubsidiaryhanksarcmembersFDIC {=)Ei/ualHousingLenders it 1997NationsBankCorporation
visitusatwww.nationsbank.com
rheMedical Collegeof
Georgiahas had many 2 AtaGlance
high pointsduring its Asthmascreenings, helpforhighly stressedmothers andnipping eating disorders in
170-yearhistory,but thebud arejust afewofthepediatric initiatives atthe MedicalCollege ofGeorgia
seldom hasthe university Children's Medical Center.
had morecause tocelebrate than
now. Thisfall, MCG will fulfillone 41 Technologyand TLC
ofits loftiestgoals andgreatest The new MedicalCollegeofGeorgiaChildren's Medical Centercombines
dreams: theopening ofthe new technology and tenderlovingcare tocreate asecond-to-none healingenvironment
Medical CollegeofGeorgia forchildren.
Children's Medical Center.
Thenew Children's Medical 71 CircleofChildren
Centeris featuredin thiseditionof In herrolesasCMC Administratorand mom toT.J., Elizabeth Ostric is surrounded
MedicalCollegeofGeorgia Today. bychildren. She wouldn'thave itany otherway.
The facility has been inthe planning
stagesforyears, andnodetail has 101 ThumbsUp
beenoverlooked. Healthcarepro- When 12-year-oldJoshChance'sthumb wasripped offinatractoraccident. MCG's
fessionals,community members, reattachment team sprang intoactionto make him whole again.
parents andchildren have all pro-
vided inputtocreate a facility that is 131 FitforaKid
family-centered fromtheground up. MCG researchers are helpingyoung teens make lifestylechanges thatcan paydivi-
We invite youtoreadall aboutthe dends forlife.
Children's Medical Centerinthis
edition ofthemagazine. 141 TheGiftofSight —
In addition toreadingaboutthe Phillip Hunter'seye diseasethreatened todoom himtoalifeofdarkness until the
CMC
nutsandboltsofthe facility itself, stepped in.
we inviteyou tobecome acquainted
177AlumNews
with someofthepeople involved.
Read, forinstance, about MCG's News from the five alumni associations.
work helping teenslearn now how
to headoffheartdisease downthe 371 Plan YourGiving
road. Readalsoaboutachild whose Giftsofreal estate tothe Medical College ofGeorgia.
sightwas savedby MCG ophthal-
mologists, andaboutthe remarkable
effortsofMCG'sreattachment MCGPresident: FrancisJ.Tedesco,M.D Editor: ChristineHurleyDeriso
ExecutiveEditor: JamesB.Osborne.Ed.D. ArtDirector: BrentD.Burch
team.
DirectorofMarketingandPublicRelations: Photographer: PhilJones
Thesearticles,ofcourse, only DaleCrail
skimthe surfaceofthe many ©1998.MedicalCollegeofGeorgia.TheMedicalCollegeofGeorgiaisthehealthsciencesuniversityofthe
achievementsthatunfoldday in and UniversitySystemofGeorgia.Focusingonhealth-careeducation,researchandpatientcare,theAugusta-based
dayoutattheMCGChildren's institutionconsistsofMCGHospital,morethan80supportclinics,statewideoutreachprogramsandtheSchools
MedicalCenter. We thinktheCMC ofAMleldiiedcaHleaClotlhleSgceieonfceGse,orDgeintaisTtordy.ayGrisadsupaotnesoSrteuddibeys.gMreandtiscifnreomanMdCNGursFionugn.dation,Inc.andtheMCGSchoolof
is oneofthebrightest gems inthe MedicineAlumniAssociation.ItisproducedbytheDivisionsofInstitutionalRelationsandHealthCommunication;
estdaitteioonfoGfeotrhgeimaa.gAafztienre,rewaedihngoptehis AfMuuergdnuiiscsathlaedMCaotolglaaezlgiuenmeno,ifG(ae7no0d6r)gfri7iae2;n2dA-su5go8uf3s3Mt,aC,PG.GOew.oirtBghoioxaut31c04h90a15r2,g.eA.uAgdTvuheserttaai.pspiGeneagorraignnicqaueir3oi0fe9as0d3sv.heorPutulibdsleibmseehndetidsreqicuntatrehtdiestrolpyuM,bilMikceCatGDiooTnwonddeoaesysaintsot
you'll agree. constituteanendorsementbytheMedicalCollegeofGeorgiaoftheproductsorservicesadvertised.
o
glance
ot
Breathing Easier A Helping Hand
edical College ofGeorgiaresearchers wanttoalert The MCG Children's Medical Centeris matchinghighly
parentsand teachers thatphysical inactivity inchil- stressednew mothers with volunteerstohelpthem
may sIidgrnaelnamsatyhmsau.ggest more than adistaste forexercise. It TthheroCuMghCthFeiirrstdiSftfeicpusltpireso.gram wasdevelopedby the
MCG nurses and respiratorytherapists recently screened GeorgiaCouncil on ChildAbuse and isfundedbythe
176 students at RichmondCounty's Hornsby Elementary Children'sTrust Fund. Poverty, youth, inexperience, adif-
School forbreathing problems. "Thirty-twopercentof ficult pregnancy and/ora sick newborn are some stressors
MCG
those testedhad possible breathing problems," saidnurse thatcan hindereffectiveparenting, says clinical
practitionerVirginia Kemp. "A scary thing is that 80per- nurse specialistCheryl D. Piatt. First Steps identifies these
centofthose were not identifiedin the school as having highly stressed mothers, ideally before theygivebirth, and
breathingproblems." pairsthem with amentorwell-versed inchild-rearing. "We
Thosechildren often simply avoid physicalexertion are providingemotionalcare tomoms by havingthe volun-
ratherthandraw attention totheirlimitations, the teers go intotheirhomes," says First StepsCoordinator
researchers said. Buttheiravoidanceofthe problemcomes AliceJohnson. "Wearetrainingourmomsby helping them
atacost. "Studies suggestthat ifyoudon'ttreatasthma gettoknow themselvesand theirchildren."
early, itcan become chronic." saidrespiratory therapist
Randy Baker. "Withearly intervention andpropertreat-
ment, you may decrease long-term problems." Making the Grade
The researchers hopetoexpandtheirscreening andedu- Dr. William
cational efforts, identifying children with breathing prob- CMC teacherTracy Kormylomakes sure that B. Strong,
lems. As wasthecase with the Hornsby students, parents hospitalized and/orchronically ill children Chiefof
then wouldbe urged tocontact theirpediatricianorwould keep uptheirschoolwork. In apilotpro- Pediatric
receive referrals upon request totreat the problem. gram, oneCMCpatient"attends" herregular Cardiology,
with patient
Eating-Disorders Alert 1
Dentists may bethe first lineofdefense in puttingthe
brakes oneating disorders. Swollen salivary glands,
downy facial hairandanacidic residue in the mouth
—
can signal bulimiaoranorexia anddentists areoftenthe
firsttospot the problem. "Primarily the acidcausesdamage
which leadstodeteriorationofenamel," says Dr. James
MCG
Curtis, Assistant ProfessorofOral Rehabilitation.
When he suspects bulimia, hegently inquires abouthis
patient'seating habits.
"It'simportanttobe sensitive and non-judgmental," he
says. "Mostpatientsdeny they arebulimic, butatleastthe
idea is planted that someone suspects something is wrong."
Knowledge isessential inrecognizing indicationsofthe
disease,he says. "The idea," Dr. Curtis said, "is totreatthe
wholepatient and notjustthe dental problems."
Patientsdiagnosed with aneatingdisordercanbe
referredto specialists in thefield. Dr. Christian Lemmon
directsMCG'sEating Disorders Program, tacklingthe
—
problematevery level includingtheemotional issuesthat
triggeredthe problem.
2 MEDICALCOLLEGEOFGEORGIATODAY
class,even when hospitalizedorhomebound, using televi-
sion-based videoconferencing. No matterwherethe patient
is, shecan maintaincontact with both Ms. Kormyloandher
CMC
middle school teacher. Sucheffortsensure that
patients learn theirschoolworkand maintain asnormal
livesas possible,even in the midst ofmedical treatment.
What's for Lunch?
Ifyouaskyourchild what he had forlunch in his school
MCG
I cafeteria, his answermightbe less than reliable.
I Associate ProfessorofNutrition Suzi Domel Baxternotes
thatchildren's self-reportsoftheirdietsare farfrom inac-
curate:just becauseJohnny says heate hiscarrots, inother
words,don'tcounton it. Such misleading informationcan
skew researchthat links nutrition andhealth. Dr. Baxter
observedchildreneating lunch in elementary schools, then
interviewedthem attimedintervals afterward about what
theyateand how muchthey liked it. She foundthatthe
accuracyofthechildren's self-reportsdecreasedas the time
interval lengthened.
Herresearch alsoenabledhertoobservebehaviorsby
teachers andschool aidesthat might negatively impactchil-
dren's foodpreferences. "Inordertohelpchildren eatmore
healthfully," she said, "we needtoassess whattheyare
eating."
A Team Effort
CG is takingateamapproach totreating spasticity,a
I
commonandpotentially disablingchange in muscle
tone. Commoncausesofspasticity inchildren
I
includecerebral palsy, strokes andhead injuries.
Centralized,comprehensivecare is importantformaxi-
mizingtreatmentanddevelopingcenterstocompiledatato
MCG
measuretheeffectivenessoftreatments, said neuro-
surgeonJohn Vender. "Thegoal ofthisnew service," he
said, "istoreduce spasticity and spasms and improve qual-
ity oflife."Theteam includes neurologists, neurosurgeons,
occupational therapists, physicaltherapists, social workers
andcounselors whoworktodetermine theoptimal treat-
mentplan, which may include medication, surgery orboth. CMC patient
Grayson
Diabetes Screening
Wyattwith
Bedside Tool mom Pam
CMC
A The is participating inastudy toidentify
testthatcanbeusedatthebedside ofacritically ill those—atriskforType One insulin-dependentdia-
childtomeasurebloodflow velocity in thebrain may betes then helpthem prevent it. The study screens
helpdeterminethechild'schanceofsurvival. diabetics' first-degree relatives forislet cell antibodies, an
MCG
researcherscoordinateda six-yearstudy using early indicatorofthe disease, in which the pancreas's
transcranial Doppler, a non-invasive test using sound waves inability toproduce insulinefficientlycanwage waron
tomeasurebrain blood flow, toexamine 206children with organsthroughoutthe body.
asevere brain injury. In 81 ofthe children, doctors identi- Ifantibodiesare found, participantsgetafollow-uptest,
fiedtwoabnormal blood flow patterns thatappeartobe thenenteraprevention program ifthey are foundtohave
excellent predictorsofwhetherachild will surviveorsig- markersforthe—disease. The program isdesigned todeter-
nificantly recoverfromhisbrain injury. mine ifins—ulin knowntobe alifesaveroncethedisease is
"Ifthis finding isconfirmed in a largerstudy, thenwe diagnosed can halt the disease'sdevelopment. "Ifyou
have abedsidetool wecanuseto serially monitorthese don't yet havediabetes, but dohave markers that you might
children," said MCG pediatric intensivist EdwardJ. develop it, thebody'sexposure to insulin appearsto protect
Truemper. the pancreas sothe immune system won'ttarget it forfur-
therdestruction," saidpediatric endocrinologist WilliamH.
Hoffman.
VOLUME26, NUMBER 3/SPRING 1998 3
MCGAmbulatoryCareCenter MCGFacultyOfficeBuilding MCGAmbulatoryCareCenter
ParkingDeck
FIRST FLOOR
R Restrooms E PublicElevator Reception I WelcomeCenter Telephone
by Sally Simkins
lotaday goesbythat couldnothave plannedabetterplace for Design AwardsCompetition sponsored
Elizabeth Ostric does- children, she said. by Modern Healthcare magazine and the
n't walkordrivedown The new MCGChildren's Medical American InstituteofArchitects'
^/ HarperStreet. It's not Centeravoidsthe tendency totreat space Academy ofArchitecture forHealth. The
Q necessaryforhertogo forchildren with aconventional play- awards recognizeexcellence in designing
thatway togettowork in the morningsor house mentality, according tojudges who and planning new and remodeled health
go home at night. It's the scenery that selected it awinner in the 12th annual care facilities.
drawsherthere: theconstruction siteof
the new MedicalCollegeofGeorgia
Children's Medical Center. MCG
Ambulatory
"When I see it, I am inawe," Ms. CareCente
CMC
Ostric, Administrator, saidof Neuro-
the newCMC, which will bededicated pOsfyfcihcoelaongdy
May I. Ms. Ostric wasn't in Augusta ClinicalSpace
when ground wasbrokenforthe new ToMCG•«H-ospital PsychiCahitlrdy
Faculty
hospital in November 1995. At the time, Offices
she wasavicepresidentatLeBonheur
Children's Medical Centerin Memphis,
Tenn. Shecame to MCG in spring 1996,
five monthsafterseveral young patients
helpedturnthe soil with theceremonial
ground-breaking shovels. SuppCoorntneScetrovircteos FLOOR
"Thebuilding'scharacterand person-
aMlCitGy,arewonrokwinegmewrigthinCg,M"CMsf.amOislitersi,ccsaoimd-. SeatingArea QTelepho
munity members, architects andbuilders,
4 MEDICALCOLLEGEOFGEORGIATODAY
—
ronments forchildren andtheirfamilies.
MCG The natureand technologyexperience is
Ambulatory J
CareCenter I* nh Id progressive throughout the facility, from
1 theentry plaza's natural arborwhere fruit
ToMCGHospital PRreecoopvaenrdyRPhoaosmesII trees will provide asymbol oflife, tothe
SurgeryandOutpatientProcedures lobby where nature and technology are
l!E_TlSteravaiarustmoars ELleSvBtaaaftcfokrsRdeocoorvPehrayseRPoIeodimastric cteocmhbnionloegdicianlaavribdoerowahqeuraerithuemsainghdtstoatnhde
Pharmacy toPICU IntensiveCare sounds ofnature will provide an intrigu-
(PICU)
Lab ing and imaginative pathway todiagnos-
. ,
tic and treatment areas.
The videoaquarium iscomprisedofa
large grouping ofvideomonitors that will
Endoscopy/Special
ProceduresRooms FLOOR project asingle imageofan aquarium
showcasing anexotic underseaworld.
T H R D
I Dolphins, whales, seahorses and other
R Restrooms E Elevator Reception SeatingArea Telepho ocean life willbe featured, whileocean
sounds will be heard in adjoining waiting
"This projecttransmitsexuberance they stuckthe needle in. Thecolored areas.
andexcitement," saidjudge Merlin rooms would make it better." A warmlycolored fossil flooring in
MCG the lobby will lead tothe receptionarea;
Lickhalter. "Thisisareal designatthe Paul saidthe Children's
rightscale in which technology andten- Medical Centeris a lotdifferent from several largedinosaurfossils will be
derlovingcare seemtocometogether otherhospitalshe's seen. The designof etched intothe walls, showing them
lumberingdown thecorridortowardthe
naturally." the facility focuseson nature and technol-
Judge FrankGrauman saidthe facili- ogy, integratinghealthcare, education Family Resource Library.
tayn'dsfdaemsiilgynssphaocwes—"reexaclelplleancceesfinorpapteioepnlte andentertainmenttocreate healingenvi- patThhweaytetcohanlilcatlreaartbmoerntwialrleamsarinktthheefive-
tospendtime andspendit well."
JudgeWilliam Powandacalledit MCG
Ambulatory
a superbarchitectural achievement CareCenter
respondingtothe needsand interestsof
patients.
And well itshould. Patientsandtheir ToMCGHospital
families helpeddesign it. They said what ETlervaautmoars [treatment —1 StafT
they wanted, andthe architectural firm Stairs Room "Elevators
Stanley, Beaman and SearsofAtlanta Confer- Treat-
ence ment
incorporatedtheirideas intotheirplans. Room Room
"They made averyconcertedeffort
tobe sure thatthe hospital wouldbe I Consult
orientedtoward the patientsand <itAir«; '-
families," said RogerLeDuc ofAiken, FOURTH FLOOR
S. C,whose 13-year-oldson, Paul,has
CMC
been a patientoverthe years. "They
evenhad ushelptry out the furniture to R Restrooms E Elevator SeatingArea | |NursesStation j |PatientRooms Telephone
be sure itwascomfortable, knowing that
parents wouldbetheones sitting forlong
periodsoftime.
"They talked with kids from5 years
oldtotheirmid-teenstofindoutwhat
matterstothem," Mr. LeDuc said.
His son,Paul, servesontheChildren's
AdvisoryCouncil—KidsART(Archi-
—
tectural and RecreationalTeam) which
helpeddeveloptheCMC. "We all gave
suggestions,"he said. "I suggestedthat
they have fruit salads with lunchanddin-
ner, withthings like pineappleand kiwi
thingsthataregood foryou.
"I also suggestedthatthey paint the
wallsdifferentcolors intheexam rooms," FIFTH FLOOR
hecontinued. "Haveone speckled room,
apinroatthese.rWpohleknadIowtaasnda lainttoltehkeird,onIediwdint'ht R Restrooms E Elevator '. SeatingArea NursesStation PatientRooms Telephone
like togetbloodtests. Itwouldhurt when
VOLUME26, NUMBER 3/SPRING 1998
storybuilding. A seriesofvideototems informationforyoung people throughthe attheCMC toexaminepatients inclinics
will appearthroughout—thearbortodis- MCGGeorgiaInstituteforthe Prevention andhospitals hundredsofmilesaway
play images ofnature waterfalls,rain ofHumanDiseaseand Accidents. And, and, muchofthetime,eliminate the need
forests, gardens andmountains. Sounds insteadofchildren andfamilies from forfamiliestotravel.
ofnature will be heardalongthepath. throughoutGeorgiaalwaystravelingto Asaclinical facilityofGeorgia's
The interiordesign isagreentheme; theCMC in Augusta, healthcare health sciencesuniversity, MCG
technological tree canopiesconstructedof providersattheCMC travel regularly to Children's MedicalCenterisadynamic
computercircuit boards accenttheentries satelliteclinics in theGeorgiacitiesof teachingenvironmentwherethe most
ofeachdepartment. Waycross, Brunswick, Savannah, current approachestohealthcareare
Toencourageparentstoremain Valdosta, Columbus, WarnerRobins, practiced, taught and, often, discovered.
actively involved in theirchild'scare,as Macon, Athens, Moultrie,Thomasville, Dr. WilliamP. KantoJr., Chairmanof
well as fortheircomfort, all roomswill Fitzgerald. Albany and Dublin. the DepartmentofPediatrics and Medical
have trundlebeds forfamily use. There Technology alsocan reducethe need DirectoroftheCMC, saidtheCMC
alsowill be family lounges withcomfort- forfamiliestotravel forhealthcare. The intendstobeoneofthe top 10children's
able seating in aliving-roomatmosphere, MCGTelemedicineCenterandthe medicalcenters in the country. "We will
kitchenettesand laundry facilities. The GeorgiaStatewideTelemedicineProgram dothisby providingthe finest technical
Pediatric Intensive Care Unitwill have usehigh-resolution videocameras and care inacompassionate, family-centered
roomforparents to stay neartheirchil- computers linked togetherviaaspecial environment,"he said.
dren around theclock. Anoutdoorroof groupingoftelephone lines andfiber-
garden on the fourth floorwill offer opticcablestoenabledoctors
patientsand family members apeaceful
diversion.
PatriciaSodomka, Executive Director
MCG
of Hospital andClinics, sees the
facility as asourceofhope and strength, a
place where families know they can feel You are cordially invited
veryconfident that are going toget the
bestcare. new
"When achild is ill, it is stressful for dedication of the
the whole family." Ms. Sodomkasaid. to the
"We want familiesto feel like this is their
place. It's meant forthem." Georgia
Andthe wholecommunity will be College of
Medical
involvedand represented, she noted.
Community physicians, many ofwhom
will serve asCMC partners, "are in many Medical Center
wayskey toourultimate success," Ms. Children's
Sodomka said.
ThenewCMC will haveitsownemer-
gency room andpediatric traumacenter,
operating rooms, laboratories, radiology Harper Street *
suite, admissionsprocessandparking. Its
proximity toMCG'sotherclinical facili-
tieswill allow ittocontinuetomake use
10 a.m.
ofthose vastresourcesaswell.
The 220,000-square-foot hospital
will replaceexisting inpatientpediatric
facilities locatedprimarily on theeighth May 1.1998
MCG
floorof Hospital andwill beeasily V
M
accessible fromthe pediatric outpatient
MCG
facilitieson the thirdfloorofthe
AmbulatoryCareCenter. It will increase SPEAKER
from 111 to 149 the numberofbeds KEYNOTE
dedicatedtothecareofsickandinjured
children.
The servicesofthe MCGChildren's The Honorable Zell Miller
Medical Centeraren't limitedtothe facil-
MCG
ity in Augusta. doctorstaketheir
Georgia
prevention message intoGeorgia'sclass- Governor of
rooms, givingchildren, teen-agers and
theirparents the information they needto
livehealthierlives. Some visits are in
person, others viathe state'sdistance-
learning network.
TheCMC also isgenerating wellness
6 MEDICALCOLLEGEOFGEORGIATODAY
by CaroleJ. Smith
Children encircle Elizabeth
—
Ostric's life profession-
ally, as Administratorofthe
Medical Collegeof
Georgia'sChildren Medical
Center, and personally, as mothertoher
2-year-oldson,T.J.
"I don't have any disconnections in
my lifebetween where my heart is with
children and what I do formy living,"
said Ms. Ostric. "I'm very fortunate
becausemostpeopledon'tgettohave
that in theirwork."
A nativeofNew Bedford, Mass., Ms.
Ostric receivedherbachelorofarts
degree with adouble majorinbiochem-
istryandhistory from SmithCollege and
hermasterofhealth administration and
planningdegreefromWashington
University School ofMedicine.
Followingan administrativeresidency
atLeBonheurChildren's Medical Center
in Memphis,Tenn., shejoinedLe
Bonheur's staffand workedin various
capacities including Directorof
AdmissionsandTelecommunications,
people, given theopportunity, will create,
succeed andexcel betterasagroupthan
any oneperson's visioncouldhave suc-
ceeded inbuilding a wonderful CMC,"
Ms. Ostric said.
Dr. Kantobelieves Ms. Ostric'senthu-
siasm, vision andexperiencehave been a
valuablecatalyst in thedevelopmentof
theCMC. "She possesses aunique blend
ofthe understanding andvision necessary
toprovide leadershiptoachildren's med-
ical centerthat ishousedwithin an acade-
mic health sciencecenter, which must
alsoberesponsivetothecommunity,"
saidDr. Kanto.
Ms. Ostricbelievesthatwithin five
yearstheCMC will be well on its wayto
fulfilling the visionoffamily-centered
careby serving as manychildren, from
infants to youngadults, and families as
possible.
"Ithink people will comehere who
aredesperately ill, but I thinkpeople will
alsouseourhospital asahealth resource
toboost the healthofthemselvesand
theirfamilies," said Ms. Ostric. "Because
ofthe people whoare involved, whether
it'sthe Children'sAdvisoryCouncil,the
Family AdvisoryCouncil, the medical
stafforthe volunteers, I thinkyougeta
senseofthe factthat we'rebuilding
something that's unique and special." She
alsonoted the invaluablecontributionof
Memphis." community physicians, whoareforming
During MCG
partnerships with toensure thatthe
herinterview
Children's Medical Centerreachesoutto
process, Ms. theentirecommunity andbeyond.
Ostric was impressed Ms. Ostric's move totheCMCcoin-
theCbMyCthefrcoommmtihetmceonmtmuto- coifdaendo,tihreorniocfalhleyr,gwoiatlhs:thmeotmahteerrhioaoldiz.atFioorn
nity, the staffand family mem- three years, Ms. Ostric waitedonalistto
bers likeJulie Moretz, whose son, becomean adoptive parent. Twenty-four
Daniel, was born with congenital heart hours before she sold herhouse in
defects andtreatedatthe CMC. MCG's Memphistorelocate to Augusta, her
reputation as an outstandingacademic social workernotified herthat a6-month-
AssistantVice PresidentofFinance and institution was anotherattraction. oldboy wasavailabl—e.
jVoiicneinPgreMsiCdGentinof19O9p6e,raMtsio.nsO.stBriecfowraes pro"gIrahmasdthheaatrdMCfrGomgpreaodpulaeteidnstoramienionfg GerUbepronbasbeye—ingheTr.Jh.eartthweaismacagpetiovfattehde.
Vice PresidentofProgram Development thebestpediatricians in thecountry," said "Itwasoneofthose things," said Ms.
ofLe BonheurHealth Systems, Inc. Ms. Ostric. "I didn't want tomiss being Ostric. "I havetwothings that I've
12yLeeaarvs,inbgutTetnheneospspeoertwunaistydiftfoibcueltaacfhtielr- partMosf.sSuocdhoamhkiaghb-eqluiaelvietsyMinCstGituwtaiosn.f"or- atolwbaeytshewaandtmeindistotrdaot.orI'ovfeaalchwialydsrewna'nsted
dren's medicalcenteradministrator, one tunate toattract Ms. Ostric. hospital, and I've always wantedtobea
ofherlifelonggoals, luredherto "Elizabeth is averycreative,ener- mom. Sothefactthey both happenedthe
Georgia. MCG administrators,faculty getic, visionary leaderwhobringsjustthe same week wasjustan overwhelming
and staffalso influenced herdecisionto right touch forboth familiesand theirlit- opportunity."
relocate. tleones, as well asfacilitatingthecollec- Now 2,T.J. is"smartasawhip"
"Pat [Sodomka, Executive Directorof tiveworkofthe faculty, the private-prac- (accordingto Mom) and attemptingto
MCG Hospital andClinics] obviously ticecommunity andtheentire staff," said findoutjusthow SantaClauscomes
hadhergoals andheartset ontryingto Ms. Sodomka. down thechimney onChristmas Eve.
provide a superbchildren's medicalcen- Kids are Ms. Ostric's favorite partof Inquisitiveminds, both athome andat
terhere," said Ms. Ostric. "I hadalready thejob,butshealsodelights in nurturing work, keepMs. Ostric's life stimulating.
metDr. [William P.] Kanto [CMC people intheircareers and watching them "Every kid's ahero," she said, "and
Medical Director] whenhe spoke ata achieve theirpotential. "1 thinkone ofmy they'rejustwaiting fortheiropportunity
conference several years agoin greatest strengths is understanding that toshowyou."
8 MEDICALCOLLEGEOFGEORGIATODAY