Table Of ContentView metadata, citation and similar papers at core.ac.uk brought to you by CORE
provided by Wageningen University & Research Publications
PlantCellRep(2009)28:963–974
DOI10.1007/s00299-009-0695-1
GENETICS AND GENOMICS
Isolation and mapping of a C30H gene (CYP98A49)
from globe artichoke, and its expression upon UV-C stress
Andrea Moglia Æ Cinzia Comino Æ Ezio Portis Æ
Alberto Acquadro Æ Ric C. H. De Vos Æ
Jules Beekwilder Æ Sergio Lanteri
Received:16January2009/Revised:10February2009/Accepted:1March2009/Publishedonline:20March2009
(cid:1)Springer-Verlag2009
Abstract Globe artichoke represents a natural source of Keywords Globe artichoke (cid:1) C30H (cid:1) Genetic mapping (cid:1)
phenolic compounds with dicaffeoylquinic acids along UV-C radiation
with their biosynthetic precursor chlorogenic acid (5-caf-
feoylquinicacid)asthepredominant molecules.Wereport
the isolation and characterization of a full-length cDNA Introduction
and promoter of a globe artichoke p-coumaroyl ester 30-
hydroxylase (CYP98A49), which is involved in both Globe artichoke (2n = 2x = 34, Cynara cardunculus L.
chlorogenic acid and lignin biosynthesis. Phylogenetic var. scolymus) is a perennial, allogamous, primarily vege-
analysesdemonstratedthatthisgenebelongstotheCYP98 tatively propagated vegetable, native to the Mediterranean
family. CYP98A49 was also heterologously expressed in basin. Its cultivation makes a considerable contribution to
yeast, in order to perform an enzymatic assay with p- the agricultural economy of southern Europe, with Italy
coumaroylshikimateandp-coumaroylquinateassubstrates. being the major world producer (about 470 Mt per year).
Real Time quantitative PCR analysis revealed that Globe artichoke is used mostly for human food, although
CYP98A49 expression is induced upon exposure to UV-C the polyphenolic content of its leaves is known to have
radiation. A single nucleotide polymorphism in the therapeutic properties. The predominant phenolics present
CYP98A49genesequenceoftwoglobeartichokevarieties in the leaf are the dicaffeoylquinic acids and chlorogenic
used for genetic mapping allowed the localization of this acid (5-caffeoylquinic acid) (Lattanzio et al. 1994; Wang
gene to linkage group 10 within the previously developed et al. 2003). These metabolites possess antioxidative,
maps. hepatoprotective, diuretic and choleretic activity (Adzet
et al. 1987; Gebhardt 1997; Brown and Rice-Evans 1998).
Leafextractshavealsobeenreportedtoinhibitcholesterol
biosynthesis, to contribute to the prevention of arterio-
sclerosis and other cardiovascular diseases (Gebhardt
1998), and may inhibit HIV integrase, a key enzyme in
NucleotidesequencedatareportedareavailableintheGenBank
viralreplicationandinsertionintohostDNA(Slaninaetal.
databaseunderaccessionnumber:FJ225121
2001).
CommunicatedbyH.Judelson. Thereconstructionofthephenylpropanoidpathwayand
the elucidation of the biological functions of secondary
A.Moglia(cid:1)C.Comino(cid:1)E.Portis(cid:1)A.Acquadro(cid:1)
metabolites is an area of active research (Douglas 1996).
S.Lanteri(&)
Phenylpropanoid compounds, which include flavonoids,
DiVaPRA,PlantGeneticsandBreeding,UniversityofTorino,
viaL.daVinci44,10095Grugliasco(TO),Italy lignin, coumarins and many small phenolic compounds,
e-mail:[email protected] contribute to a multiplicity of plant functions, such as the
strengthening of the cell wall, pigmentation of the flower,
R.C.H.DeVos(cid:1)J.Beekwilder
defense against pathogens and cell signaling (Boudet
PlantResearchInternational,P.O.Box16,
6700AAWageningen,TheNetherlands 2007).
123
964 PlantCellRep(2009)28:963–974
To date few studies on phenylpropanoid biosynthetic tobacco upon both UV-B irradiation and insect feeding
pathway have been performed in globe artichoke. Three (Cantos et al. 2001; Izaguirre et al. 2007). In globe arti-
sequences with high similarity to PAL (phenylalanine choke, we have recently shown that exposure to UV-C
ammonia-lyase), the first enzyme involved in the phenyl- consistently increases the level of the major dicaffeoyl-
propanoid pathway, have been isolated (De Paolis et al. quinic acid isomer, while the exogenous application of
2008). Moreover, gene sequences encoding hydroxycin- either methyl jasmonate or salicylic acid has no such
namoyltransferase (HCT and HQT), involved in the effect (Moglia et al. 2008). Furthermore we previously
synthesisofchlorogenicacid,havebeenrecentlyidentified generated the first genetic map of globe artichoke, based
(Cominoetal.2007,2009).Newinsightsarethusrequired on a two-way pseudo-testcross strategy (Lanteri et al.
for identifying other genes involved in caffeoylquinic acid 2006). An F population was created by crossing ‘Ro-
1
synthesis and elucidating the causal relationships between manesco clone C3’ (a late-maturing, non-spiny type) with
the various enzymes. ‘Spinoso di Palermo’ (an early-maturing spiny type), and
The 30-hydroxylation of the phenylpropanoid ring is the progeny was genotyped using a number of marker
essentialnotonlyforthesynthesisoflignin(Frankeetal. types, such as AFLP, S-SAP, SSR and M-AFLP (Lanteri
2002; Abdulrazzak et al. 2006; Chen and Dixon 2007), et al. 2006).
but is also an important step in the synthesis of chloro- Themainobjectivesofthispaperare(a)thecloningofa
genic acid (Schoch et al. 2006; Mahesh et al. 2007). C30H gene and its promoter from globe artichoke, (b) the
The CYP98 family of plant cytochromes P450 has been study of its transcriptional regulation in response to UV-C
designated as the family of enzyme that performs the irradiation and (c) the definition of the gene’s localization
meta-hydroxylation step in the phenylpropanoid pathway in a previously developed map in relation to other DNA-
(Fig. 1). This meta-hydroxylation is notcatalyzed on free based markers. The in vitro enzymatic assay of C30H was
p-coumaric acid, but on its conjugates with shikimic, also performed.
quinic or phenyllactic acids (Schoch et al. 2006). The
proteinandencodinggenesinthisfamilyarealsoreferred
to as C30H. Materials and methods
The phenylpropanoid pathway is activated upon
exposure to abiotic and biotic stresses, such as wounding, Plant material, DNA and RNA extraction
UV irradiation and pathogen attack (Dixon and Paiva
1995; Treutter 2005). The involvement in the stress Seeds of globe artichoke (‘Concerto’, Nunhems) were
response of chlorogenic acid has been reported, with its germinated on a 15-cm Petri dish on two layers of wetted
concentration increasing in lettuce upon wounding, and in filter paper, and after 2 weeks transplanted into soil-filled
Fig.1 Coumaroyl-ester a
metabolismaffectedby C3’H
recombinantCYP98genes.
NADPH+O
Conversionofa 2
p-coumaroylquinateto
5-caffeoylquinicacid
(chlorogenicacid),b
p-coumaroylshikimateto
caffeoylshikimate
p-coumaroylquinic acid caffeoylquinic acid
(chlorogenic acid)
b
C3’H
NADPH+O
2
p-coumaroylshikimic acid caffeoylshikimic acid
123
PlantCellRep(2009)28:963–974 965
10 cm pots in a glasshouse held at 22–24(cid:2)C for 10 weeks. cDNA sequence. Fragments of the expected size were
DNA was extracted from leaves, following Lanteri et al. extracted from an agarose gel, cloned into the p-GEMT-
(2001). Total RNA was extracted from approximately easy vector and sequenced.TheCYPnumberoftheisolated
100 mg fresh leaf using the Trizol reagent (Invitrogen), genewasprovidedbyDrNelson(http://drnelson.utmem.edu/
following the manufacturer’s instructions. CytochromeP450.html).Multipleglobalsequencealignments
were performed using ClustalW (http://www.ebi.ac.uk/
Cloning of the C30H gene and its promoter clustalw/),applyingdefaultparameters.Phylogeneticanaly-
sis was performed using MEGA v3.0 (Kumar et al. 2004).
Three sets of degenerate primers (COD C30H For, COD Protein sequences used for alignments were: CYP98A1
C30H Nested and COD C30H Rev, see Table 1) were (Sorghum bicolor, AAC39316), CYP98A2 (Glycine max,
designedfortheamplificationofC30Hfromtheaminoacid AAB94587),CYP98A3(A.thaliana,NP_850337),CYP98A4
sequences of conserved regions of Arabidopsis thaliana (Oryzasativa,AAU44038),CYP98A6(Lithospermumeryth-
(NP_850337), Nicotiana tabacum (ABC69384), Coffea rorhizon, AB017418), CYP98A8 (A. thaliana, NP_177594),
canephora (ABB83677), Ocimum basilicum (AAL99200), CYP98A9 (A. thaliana, NP_177595), CYP98A10 (Triticum
Medicago truncatula (ABC59086) and Sesamum indicum aestivum,CAE47489),CYP98A11(T.aestivum,CAE47490),
(AAL47545) homologs. PCR was performed from 25 ng CYP98A12 (T. aestivum, CAE47491), CYP98A13v1
template of genomic DNA following the CODEHOP (O. basilicum, AAL99200), CYP98A13v2 (O. basilicum,
strategy (Morant et al. 2002) which employs a 3 min AAL99201), CYP98A14 (Solenostemon scutellarioides,
denaturation at 94(cid:2)C, followed by 20 touch-down cycles CAD20576), CYP98A19 (Pinus taeda, AAL47685),
[(94(cid:2)C/1 min, 70(cid:2)C/2 min (reducing by 1(cid:2)C each cycle) CYP98A20 (S. indicum, AAL47545), CYP98A21 (Ammi
and 72(cid:2)C/2 min], and 29 cycles of 94(cid:2)C/1 min, primer majus, AAT06912), CYP98A27 (Populus trichocarpa,
annealing temperature/1 min and 72(cid:2)C/10 min, and fin- ACC63870), CYP98A28 (Camptotheca acuminata,
ishing with a 10 min incubation at 72(cid:2)C. The PCR AAS57921), CYP98A29 (Zea mays, assembled from GSS
fragment, A-tailed by the use of Taq DNA polymerase sequences), CYP98A33v1 (N. tabacum, ABC69384),
(Promega), was extracted from the agarose gel and cloned CYP98A35(C.canephora,ABB83676),CYP98A36(C.cane-
into the p-GEMTeasy vector (Promega, Madison, WI, phora,ABB83677),CYP98A37(M.truncatula,ABC59086),
USA). Plasmids from two colonies were sequenced using CYP98A39v1 (T. aestivum, AJ585988), CYP98A39v2
ABI310 capillary sequencer (Applied Biosystem). To (T. aestivum, AJ585990), CYP98A39v3 (T. aestivum,
assignaputativefunction,aBLASTsearchwasperformed AJ585991),CYP98A40(T.aestivum,AJ585989),CYP98A41
against Viridiplantae GenBank database. To obtain a (T. aestivum, AJ585987), CYP98A46 (Coptis japonica,
complete cDNA sequence, the SMART RACE cDNA BAF98473). The Genome Walker Universal kit (Clontech)
amplification kit (Clontech) was employed, following the was used to isolate the globe artichoke C30H promoter, fol-
manufacturer’s instructions, except for the use of an lowingthemanufacturer’sprotocol.Fragmentswereisolated
annealing temperature 5–10(cid:2)C less than was recom- after agarose gel separation, cloned into the p-GEMTeasy
mended. Specific primers were designed for 30 and 50 vectorandsequenced.Thepromoter’sregulatorymotifswere
amplification of the C30H transcript, based on the partial identifiedaccordingtoNarusakaetal.(2004).
Table1 Primersequencesused
CODC30HFor 50-GATGARGTYACHGCYATGGTTGA-30
inthisstudyforgeneisolation
(COD),forheterologous CODC30HForNested 50-GAATGGGCNATGGCVGA-30
expression(Expr),forgenetic CODC30HRev 50-ATATCRTARCCHCCRAT-30
mapping(C30H447)andfor ExprC30HFor 50-ATGACCCTCCTACTCCTCCCC-30
RT-qPCR(RT)
ExprC30HRev 50-TTACACATCCACGGCCACACG-30
C30H447OuterFor 50-AGTTGTTTTCTCCCAAGAGGCTTGAGGC-30
C30H447OuterRev 50-AGTAATGGATGGGTCACCTACCCAACCC-30
C30H447InnerFor 50-GAACGGAATGAGGATCAAACGTAGTTATCG-30
C30H447InnerRev 50-GAACGGAATGAGGATCAAACGTAGTTATCG-30
RTC30HFor 50-CTCTATCAGCGCCTCCGATT-30
RTC30HRev 50-ATATGATCGGGCCGTATTGC-30
RTActFor 50-TACTTTCTACAACGAGCTTC-30
RTActRev 50-ACATGATTTGAGTCATCTTC-30
123
966 PlantCellRep(2009)28:963–974
Heterologous expression of the C30H gene in brewers’ HPLC analyses
yeast
Enzymatic assays were analyzed by reverse-phase HPLC
TheisolatedglobeartichokeC30Hgenewasamplifiedfrom with PDA detection, as described recently (Moglia et al.
cDNA template with primers Expr C30H For and Expr 2008).Inshort,theHPLCsystemcomprisedaWaters 600
C30HRev(Table 1),modifiedtointroduceBglIIandEcoRI gradientcontroller,aWaters996PDAdetectorandacolumn
cloning sites at the 50 and 30 ends. The amplicons were incubatorheldat40(cid:2)C.Forthechromatographicseparation
cloned into p-GEMTeasy vector and sequenced using an analytical column Luna C18 (2) (2 mm 9 150 mm,
ABI310 capillary sequencer. After BglII and EcoRI 100 A˚, particle size 3 lM) with a pre-coulmn (2 mm 9
digestion, the fragments were directionally cloned into the 4 mm) from Phenomenex was used. The mobile phase
expression cassette of pYeDP60 (Pompon et al. 1996) consisted of degassed trifluoroacetic acid: ultrapure water
digestedwithBamHIandEcoRI.Saccharomycescerevisiae (1:1,000 v/v,eluateA),andtrifluoroaceticacid:acetonitrile
strain WAT11 is a derivative from strain W303-1B, in (1:1,000 v/v, eluate B), starting at 5% B, 95% A and
which yeast CPR gene (coding for a NADPH-cytochrome increasinglinearlyto35%B,65%Aover45 min.Theflow
P450 reductase) was replaced by the Arabidopsis ATR1 ratewas1 ml/min,theinjectionvolume10 ll,andtherange
(Urban et al. 1997). WAT11 was transformed using the ofdetectionwavelengthwas240–600 nm.Peakareaswere
lithium acetate/single stranded carrier DNA/polyethylene calculatedusingEmpowersoftware(Waters).
glycol method (Gietz and Woods 2002). Transformants
were selected on SGI plates (1 g/l bactocasaminoacids, UV-C treatment, and RT-qPCR assays
20 mg/l tryptophan, 6.7 g/l yeast nitrogen base, 20 g/l
glucose, 20 g/l bactoagar) and successful transformation Three globe artichoke foliar discs were exposed to UV-C
was confirmed by PCR analysis. treatment (16 W germicidal lamp during 20 min) as
described by Moglia et al. (2008). They were then ground
Enzymatic assay of the C30H activities separately to a fine powder in liquid nitrogen, and RNA
extraction was performed from 100 mg of each powdered
Yeast microsomes were isolated after 24 h of induction leaf, as described above. Primers (RT C30H For, RT C30H
on 20 g/l galactose at 30(cid:2)C, according to Pompon et al. Rev, Table 1) were designed on C30H sequence using the
(1996). The amount of total protein in microsomes was Primer3software(http://frodo.wi.mit.edu/cgi-bin/primer3/
determined according to Bradford protein assay. The sub- primer3_www.cgi). As a housekeeping gene, actin was
strate specificity of microsomal fractions, extracted from chosen for its stability and level of expression, which is
the recombinant yeast culture, was tested with p-coumaric comparable to the genes of interest and whose expression
acid, p-coumaroylshikimate and p-coumaroylquinate remainedstableaftertheUV-Cstress.Theprimers(RTAct
(kindly provided by Dr. Ullmann, Universite´ Louis For,RTActRev,Table 1)weredesignedontheglobearti-
Pasteur, Strasbourg). The negative control was represented chokeactin(ACT,AM744951).
by the microsomal fraction of yeast transformed with an For the real time quantitative PCR (RT-qPCR), cDNA
empty plasmid, and the positive control from yeast was first prepared in a 20 ll RT reaction containing 59
expressing CYP98A3 (ortholog of C30H in A. thaliana, iScript Reaction Mix (Bio-Rad), 1 ll iScript Reverse
obtained from Arabidopsis Biological Resource Center Transcriptase and 1 lg total RNA. PCR primers were
Arabidopsis, Ohio State University). C30H enzymatic designed to detect globe artichoke C30H and actin
activity was measured in 100 ll reaction tubes containing (Table 1). The cDNA was diluted to obtain a threshold
600 lM NADPH, a range of p-coumaroylshikimate con- cycle(CT)valuebetween25and35.The20 llRT-qPCRs,
centrations (0, 2, 5, 8, 10, 15, 20, 40, 60, 80, 100 and performed in triplicate for each sample, contained 19 iQ
150 lM), 100 mM sodium phosphate buffer (pH 7.4) and Supermix, 19 SYBR-Green I (iQTM, SYBR(cid:3) GreenSu-
30 lg of total microsomal proteins. The same conditions permix), 10 lM primer and 3 ll diluted cDNA. PCR
were applied with p-coumaroylquinate or p-coumaric acid reactions were carried out in 48-well optical plates using
as substrate. After starting the reaction upon addition of the iCycler Real-time PCR Detection System (Bio-Rad
the enzyme, the tubes were shaken in the dark at 30(cid:2)C Laboratories, USA). The PCR conditions comprised an
for 30 min, and the reaction was stopped by adding initial incubation of 95(cid:2)C/5 min, followed by 35 cycles of
100 ll of trifluoroacetic acid:methanol (1:1,000 v/v). The 95(cid:2)C/15 s and 60(cid:2)C/60 s. In all experiments, appropriate
reaction products were filtered through a 0.45 lM Anotop negativecontrolscontainingnotemplateweresubjectedto
10 filter (Whatman) and immediately analyzed by HPLC the same procedure to detect or exclude any possible
with photodiode array (PDA) detection, as described contamination. Melting curve analysis was performed at
below. the end of amplification.
123
PlantCellRep(2009)28:963–974 967
Standard curves were analyzed using iCycler iQ soft- fragment was obtained and showed (Blastx) high amino
ware. Amplicons were analyzed by the comparative acid similarity ([90%) with members of the CYP98A
threshold cycle method, in which DDCt is calculated as family. The original 800 bp genomic sequence included
DCtI - DCtM, where DCtI is the Ct value for the any one 171 bp intron.
target gene normalized to the endogenous housekeeping After RACE-PCR, the sequence was extended to
gene and DCtM is the Ct value for the calibrator, which is 1,524 bp, representing a 508 residue protein (CYP98A49,
also normalized to housekeeping gene. accession number FJ225121). The globe artichoke
CYP98A49 gene contains four expected P450 conserved
SNP detection and linkage analysis domains: the proline rich membrane hinge (PPGP), the
I-helixinvolvedinoxygenbindingandactivation(A/G-G-
Sequence variation in the C30H gene was sought by com- X-E/D-T-T/S), the clade signature (PERF) and the cys-
paring the copy present in the non spiny globe artichoke teine-containing region (PFGXGRRXCX) (Fig. 2).
variety ‘Romanesco C3’ with the spiny type ‘Spinoso di Aphylogenetictreewasconstructedusing30sequences
Palermo’. Parental genomic DNAs were amplified with from CYP98 family (Fig. 3). Most of the accessions are
Expr C30H For and Exp C30H Rev (Table 1), and the included in two main clusters with high bootstrap proba-
amplicons were directly sequenced to facilitate SNP bility:onecomprisesgenesderivedfromMonocotsspecies
mining. and the other one derived from Dicots and a Gymnosperm
SNPs genotyping was carried out with the tetra-primers (P. taeda) species. This division into two main groups (as
ARMS-PCR method (Ye et al. 2001) by using two sets of previously observed by Morant et al. 2007) indicates that
outer and inner primers (Table 1), designed using the the encoding genes resulted from early duplication of
software made available on-line (http://cedar.genetics. ancestral gene. As opposite CYP98A8 and CYP98A9, two
soton.ac.uk/public_html/primer1.html). PCR products were otherCYP98AmembersfromA.thaliana,andCYP98A20
separatedby2%agarosegelelectrophoresis.Thesegregation are well separated from the main clusters.Globe artichoke
dataobtainedinanestablishedmappingpopulation(Lanteri CYP98A49 grouped in a sub-cluster of five proteins, and
et al. 2006) were combined with those associated with the seemed closer to CYP98A46 from Coptis, CYP98A27
markersusedtoconstructthemapandusedtolocatethemap from Populus, CYP98A37 from Medicago and CYP98A2
positionofC30Hgene. from Glycine.
Segregation data of C30H-SNP marker were monitored In addition to the coding region, we searched the 2-kb
and analyzed in the 94 individuals of F1 progeny together sequence upstream of the ORF (FJ225121). The
withthoseof35AFLP,41S-SAP,38M-AFLPand51SSR CYP98A49 putative transcription start site was 24 bp
markers previously applied for globe artichoke map con- upstream of the ATG start codon. Upstream of this tran-
struction(Lanterietal.2006).Thegoodnessoffitbetween scriptionstartsiteareaputativeTATAbox(-32 bp)anda
observedandexpectedsegregationdatawasassessedusing putativeCAATbox(-145 bp).Thepromotercontainsthe
the Chi-square (v2) test. Independent linkage maps were following regulatory elements: recognition sites of MYB,
constructed for each parent using the double pseudo-test- MYC, DRE-core, W-Box, TGA Box, P-Box, BoxIV and
cross mapping strategy (Weeden 1994) by using JoinMap WRE1 (wound responsive element 1). All these elements,
2.0 software (Stam and Van Ooijen 1995). For both maps, exceptWRE1,werealsodetectedinthepromoterregionof
linkage groups were accepted at a LOD threshold of 4.0. Arabidopsis CYP98A3 (Fig. 4).
To determine marker order within a linkage group, the
following JoinMap parameter settings were used: In vitro enzymatic activity
Rec = 0.40, LOD = 1.0, Jump = 5. Map distances were
converted to centiMorgans using the Kosambi mapping In order to test its enzymatic activity, the CYP98A49
function (Kosambi 1944). Linkage groups were drawn protein from globe artichoke was expressed in yeast. The
using MapChart 2.1 software (Voorrips 2002). microsomal fraction was subsequently isolated and tested
for enzymatic activity in vitro using several substrates at
different concentrations. In the presence of p-coumaroyl-
Results shikimate (Fig. 5a), the recombinant protein synthesized a
compound that could be identified as caffeoylshikimate.
Gene and promoter isolation The enzymatic reaction was completely dependent on the
presence of NADPH. The same product was generated by
To isolate globe artichoke C30H coding sequences, microsomes from yeast expressing A. thaliana CYP98A3
degenerated primers were used to amplify an 800 bp (Fig. 5b, positive control), but not by yeast expressing the
fragment from leaf genomic DNA. Only one amplified empty vector (Fig. 5c, negative control).
123
968 PlantCellRep(2009)28:963–974
CCooffffeeaa MMAALLFFLLLLLLLLTTFFIIFFIILLPPPPYYYYLLYYQQKKLLRRFFKKLLPPPPGGPPRRPPLLPPVVVVGGNNLLYYDDIIKKPPVVRRFFRRCCFFAADDWWSSRRAAYYGGPP
CCyynnaarraa MMTTLLLLLLLLPPLLSSFFTTLLIILLVVAAYYAALLYYQQRRLLRRFFKKLLPPPPGGPPRRPPWWPPIIVVGGNNLLYYDDVVKKPPIIRRFFRRCCYYAAEEWWAAQQQQYYGGPP
AArraabbiiddooppssiiss MMSSWWFFLLIIAAVVAATTIIAAAAVVVVSSYYKKLLIIQQRRLLRRYYKKFFPPPPGGPPSSPPKKPPIIVVGGNNLLYYDDIIKKPPVVRRFFRRCCYYYYEEWWAAQQSSYYGGPP
**:: ::**:: :::: :: ..** ** **::****::**::******** ** **::************::****::********:: ::**:::: ******
CCooffffeeaa IIIISSVVWWFFGGSSTTLLNNVVVVVVSSNNAAEELLAAKKEEVVLLKKEENNDDQQQQLLSSDDRRHHRRSSRRSSAAAAKKFFSSRREEGGQQDDLLIIWWAADDYYGGPPHHYYVV
CCyynnaarraa IIIISSVVWWFFGGSSIILLNNVVVVVVSSNNSSEELLAAKKEEVVLLKKEEKKDDQQQQLLAADDRRHHRRSSRRSSAAAAKKFFSSRRDDGGQQDDLLIIWWAADDYYGGPPHHYYVV
AArraabbiiddooppssiiss IIIISSVVWWIIGGSSIILLNNVVVVVVSSSSAAEELLAAKKEEVVLLKKEEHHDDQQKKLLAADDRRHHRRNNRRSSTTEEAAFFSSRRNNGGQQDDLLIIWWAADDYYGGPPHHYYVV
**********::**** ************..::******************::****::**::********..****:: ******::****************************
CCooffffeeaa KKVVRRKKVVCCTTLLEELLFFSSPPKKRRLLEEAALLKKPPIIRREEDDEEVVTTAAMMVVEESSIIYYKKDDCCTTLLRREEGGSSGGQQSSLLLLVVKKKKYYLLGGTTVVAAFFNN
CCyynnaarraa KKVVRRKKVVCCTTLLEELLFFSSPPKKRRLLEEAALLRRPPIIRREEDDEEVVSSAAMMVVEESSIIFFNNDDCCIIHHPPDDKKNNGGKKSSLLLLVVKKGGYYLLGGAAVVAAFFNN
AArraabbiiddooppssiiss KKVVRRKKVVCCTTLLEELLFFTTPPKKRRLLEESSLLRRPPIIRREEDDEEVVTTAAMMVVEESSVVFFRRDDCCNNLLPPEENNRRAAKKGGLLQQLLRRKKYYLLGGAAVVAAFFNN
**********************::**********::**::**************::**********::::..**** :: ..::..** :::: ******::********
CCooffffeeaa NNIITTRRLLAAFFGGKKRRFFVVNNSSEEGGVVMMDDEEQQGGKKEEFFKKEEIITTAANNGGLLKKLLGGAASSLLAAMMAAEEHHIIPPWWLLRRWWLLFFPPLLDDEEAAAAFFAA
CCyynnaarraa NNIITTRRLLAAFFGGKKRRFFVVNNSSEEGGVVMMDDDDKKGGRR--VVKKAAIIVVAANNGGLLKKLLGGAASSLLAAMMAAEEHHIIPPWWIIRRWWFFFFPPLLEEEEEEAAFFAA
AArraabbiiddooppssiiss NNIITTRRLLAAFFGGKKRRFFMMNNAAEEGGVVVVDDEEQQGGLLEEFFKKAAIIVVSSNNGGLLKKLLGGAASSLLSSIIAAEEHHIIPPWWLLRRWWMMFFPPAADDEEKKAAFFAA
**********************::**::******::**::::** ..** **..::******************::::************::****::**** ::** ******
CCooffffeeaa KKHHGGAARRRRDDRRLLTTRRAAIIMMEEEEHHRRLLAARREEKKSSGGGGAAKKQQHHFFVVDDAALLLLTTLLKKDDKKYYDDLLSSEEDDTTIIIIGGLLLLWWDDMMIITTAAGG
CCyynnaarraa KKHHGGAARRRRDDRRLLTTRRAAIIMMDDEEHHTTAAAARRQQKKTTGGGGTTKKQQHHFFVVDDAALLLLTTLLQQQQQQYYDDLLSSEEDDTTIIIIGGLLLLWWDDMMIITTAAGG
AArraabbiiddooppssiiss EEHHGGAARRRRDDRRLLTTRRAAIIMMEEEEHHTTLLAARRQQKKSSSSGGAAKKQQHHFFVVDDAALLLLTTLLKKDDQQYYDDLLSSEEDDTTIIIIGGLLLLWWDDMMIITTAAGG
::**************************::**** ****::**::..**::**********************::::::**************************************
CCooffffeeaa MMDDTTTTAAIISSVVEEWWAAMMAAEEVVIIKKNNPPRRVVQQQQKKVVQQEEEELLDDQQVVIIGGYYEERRVVMMIIEETTDDFFSSNNLLPPYYLLQQSSVVAAKKEESSLLRRLL
CCyynnaarraa MMDDTTTTAAIISSVVEEWWAAMMAAEELLIIKKNNPPRRVVQQQQKKAAQQEEEELLDDRRVVIIGGYYEERRVVLLTTEEPPDDFFSSSSLLPPYYLLQQCCVVAAKKEEAALLRRLL
AArraabbiiddooppssiiss MMDDTTTTAAIITTAAEEWWAAMMAAEEMMIIKKNNPPRRVVQQQQKKVVQQEEEEFFDDRRVVVVGGLLDDRRIILLTTEEAADDFFSSRRLLPPYYLLQQCCVVVVKKEESSFFRRLL
************::..************::******************..******::**::**::** ::**:::: **..****** **********..**..****::::****
CCooffffeeaa HHPPPPTTPPLLMMLLPPHHRRSSNNAASSVVKKIIGGGGYYDDIIPPKKGGSSNNVVHHVVNNVVWWAAVVAARRDDPPAAVVWWRRNNPPLLEEFFRRPPEERRFFLLEEEEDDVVDD
CCyynnaarraa HHPPPPTTPPLLMMLLPPHHKKAANNSSNNVVKKIIGGGGYYDDIIPPKKGGSSNNVVHHVVNNVVWWAAVVAARRDDPPAATTWWKKNNPPLLEEFFRRPPEERRFFLLEEEEDDVVDD
AArraabbiiddooppssiiss HHPPPPTTPPLLMMLLPPHHRRSSNNAADDVVKKIIGGGGYYDDIIPPKKGGSSNNVVHHVVNNVVWWAAVVAARRDDPPAAVVWWKKNNPPFFEEFFRRPPEERRFFLLEEEEDDVVDD
********************::::**::..****************************************************..**::****::**************************
CCooffffeeaa MMKKGGHHDDFFRRLLLLPPFFGGAAGGRRRRVVCCPPGGAAQQLLGGIINNLLVVTTSSMMLLGGHHLLLLHHHHFFNNWWAAPPPPHHGGLLSSPPDDEEIIDDMMGGEESSPPGGLL
CCyynnaarraa MMKKGGHHDDYYRRLLLLPPFFGGAAGGRRRRVVCCPPGGAAQQLLGGIINNLLVVTTSSMMLLGGHHLLVVHHHHFFSSWWAAPPAADDGGLLSSPPEEEEIIDDMMSSEENNPPGGLL
AArraabbiiddooppssiiss MMKKGGHHDDFFRRLLLLPPFFGGAAGGRRRRVVCCPPGGAAQQLLGGIINNLLVVTTSSMMMMSSHHLLLLHHHHFFVVWWTTPPPPQQGGTTKKPPEEEEIIDDMMSSEENNPPGGLL
**********::**************************************************::..****::****** **::**....** ..**::********..**..******
CCooffffeeaa VVTTYYMMRRTTAALLRRAAVVPPTTPPRRLLPPSSHHLLYYEERRVVAAVVDDMM 550088
CCyynnaarraa VVTTYYMMRRTTPPLLQQAAIIPPTTPPRRLLPPAAMMLLYYKKRRVVAAVVDDVV 550077
AArraabbiiddooppssiiss VVTTYYMMRRTTPPVVQQAAVVAATTPPRRLLPPSSDDLLYYKKRRVVPPYYDDMM 550088
************..::::**::..**********:: ****::****.. **::
Fig.2 Amino acid sequences of globe artichoke CYP98A49 (FJ225121), Arabidopsis CYP98A3 (NP850337) and coffee CYP98A36
(ABB83677).TheP450conserveddomainsaresurroundedinboxes
Moreover,theenzymewasabletoconvertp-coumaroyl- by RT-qPCR, using actin to normalize the expression
quinateinto5-O-caffeoylquinate(=chlorogenicacid)although levels.Standardcurvesforeachamplificationsystem(data
the reaction was much less efficient and required a higher not shown) revealed a correlation coefficient r[0.99 and
concentrationofsubstrate(100 lM)togenerateadetectable efficiency higher than 90%, as indicated by slope values.
product. However, the low enzymatic activity hampered The level of CYP98A49 transcripts in UV-exposed leaves
anyaccurateevaluationofenzymaticaffinity.Inthepresence was 4.2 ± 0.95 (n = 3) fold higher than that of the non-
ofp-coumaricacid,noenzymaticconversionwasdetectedat irradiatedcontrolleaves,indicatingincreasedexpressionof
all(datanotshown). this gene upon UV-C treatment.
UV-induced response SNP detection and linkage analysis
TherelativeexpressionoftheCYP98A49geneinresponse A comparison of the CYP98A49 genomic sequence of
toUV-Cexposureofglobeartichokeleaveswasmeasured ‘Romanesco C3’ and ‘Spinoso di Palermo’ resulted in the
123
PlantCellRep(2009)28:963–974 969
Fig.3 Neighbor-joiningtree 5500 CCYYPP9988AA22 GGllyycciinnee
phylogeneticanalysisofglobe
artichokeCYP98A49.The 3355 CCYYPP9988AA3377MMeeddiiccaaggoo
lengthofthelinesindicatesthe
1133 CCYYPP9988AA2277PPooppuulluuss
relativedistancebetweennodes.
Thelistofcytochromep450s CCYYPP9988AA4499CCyynnaarraa
updatedbyDr.Nelsonat
http://drnelson.utmem.edu/ 11443344 CCYYPP9988AA4466 CCooppttiiss
CytochromeP450.htmlwasthe
3388 CCYYPP9988AA2211AAmmmmii
startingpointfortheanalysis
CCYYPP9988AA3366CCooffffeeaa
55881111 CCYYPP9988AA1144SSoolleennoosstteemmoonn
CCYYPP9988AA1133vv11 OOcciimmuumm
5599
9922 110000 CCYYPP9988AA1133vv22 OOcciimmuumm
CCYYPP9988AA33 AArraabbiiddooppssiiss
5555
CCYYPP9988AA1199 PPiinnuuss
CCYYPP9988AA2288 CCaammppttootthheeccaa
CCYYPP9988AA66 LLiitthhoossppeerrmmuumm
3377
7777 8855 CCYYPP9988AA3333vv11 NNiiccoottiiaannaa
7766 CCYYPP9988AA3355CCooffffeeaa
CCYYPP9988AA1122 TTrriittiiccuumm
110000 CCYYPP9988AA11SSoorrgghhuumm
6677 CCYYPP9988AA2299ZZeeaa
110000
CCYYPP9988AA44OOrryyzzaa
110000 CCYYPP9988AA1100TTrriittiiccuumm
110000
CCYYPP9988AA1111TTrriittiiccuumm
9911 CCYYPP9988AA4400TTrriittiiccuumm
CCYYPP9988AA4411PP TTrriittiiccuumm
110000
CCYYPP9988AA3399vv11 TTrriittiiccuumm
8800
CCYYPP9988AA3399vv22 TTrriittiiccuumm
110000
8800 CCYYPP9988AA3399vv33 TTrriittiiccuumm
CCYYPP9988AA2200SSeessaammuumm
CCYYPP9988AA88 AArraabbiiddooppssiiss
110000 CCYYPP9988AA99AArraabbiiddooppssiiss
00..0055
-2000 -1500 -1000 -500 0
MMcc MMcc MMcc MMbb MMbbMMcc IVIV MM bb M Mbb MMcc W W WWrrMMbb D D TT PP Cc
DD MMcc MMbb TT MMcc MMccTT PP WW MMbb MMbbMMbb IIVV MMbb PP PP At
Fig.4 Thelocalizationofcis-actingelementsinthepromoterregion (Mc), DRE-core (D), W-box (W), TGA box (T), P-Box (P), BoxIV
ofCYP98A3ofArabidopsis(At)andofglobeartichokeCYP98A49 (IV),WRE-1(Wr)
(Cc). In particular are shown recognition sites of MYB (Mb), MYC
123
970 PlantCellRep(2009)28:963–974
Fig.5 HPLC-PDAanalysisofreactionproductsofyeastmicrosomes plasmid(c).Chromatogramsarerecordedat312nm.PeakX1isthe
containing globe artichoke CYP98A49 (a) or A. thaliana CYP98A3 substrate; while the other peaks close to it (X2, X3) represent other
(b) using p-coumaroylshikimate as a substrate (50lM). Control isomers(3and4)ofp-coumaroylshikimate.Theinjectionvolumewas
reactions were derived from yeast transformed with the empty 10ll
SSpp xx RRoo FF11
Fig.6 Single nucleotide polymorphism segregation in a mapping population, as detected by tetra-primers ARMS-PCR on agarose gel.
RomanescoC3(Ro)andSpinosodiPalermo(Sp)
identification of one nucleotide difference at position 447 determined (Lanteri et al. 2006) are slightly changed, as
(data not shown). The tetra primers ARMS-PCR assay two inversions and a small shift of a few centimorgans
demonstrates that both parents are heterozygous at this were detected (Fig. 7).
baseposition.TheC30Hsnp447locussegregatedina1:2:1
ratio (v2 = 2.80, P[0.1) in the mapping population
(Fig. 6), and mapped to linkage group 10 in both maps, Discussion
*2 cMfromthemicrosatellitelocusCELMS-39and8 cM
from the AFLP locus p45/m47-07 (Fig. 7). Twenty-one TheP450proteinsformalargefamilyofenzymesinvolved
markers were assigned to the female LG 10: four micro- inplantmetabolism,butthefunctionofabout80%ofthem
satellites (CELMS-04, -20, -39 and CLIB-04), two S-SAP remains unknown. The A. thaliana genome includes 273
(cyre5 markers), 2 M-AFLP (polyGA markers) and 12 cytochromeP450genesdistributedin45familiesandsub-
AFLP together with SNP-C30H, covering 84.4 cM and a families (http://drnelson.utmem.edu/Arablinks.html).
mean inter-marker distance of 4.22 cM. The majority of Globe artichoke CYP98A49 sequence is highly homo-
map interval (70%) was\5 cM and three gaps of 8 cM logous to some of the other CYP98 genes (up to 86%
were present. The male LG 10 was composed of 18 of identity and 93% of similarity to CYP98A46 from
markers: two microsatellite (CELMS-04 and -39) one C.japonica),andcontainstheconserveddomainsassociated
S-SAP, 14 AFLP and the SNP-C30H, spanned 99.4 cM with P450 family members (Fig. 2). The 30-hydroxylation
with a marker density of5.84 cM. Three large caps longer step is critical in the synthesis of phenolic compounds.
than 12 cM were detected. Nine intercross markers (com- Most of the members of the CYP98 family, described to
prising C30H gene) were shared between the parents, date, metabolize shikimate esters of p-coumaric acid more
allowingthealignmentofthematernalandpaternalLG10 efficiently than quinate esters (Schoch et al. 2001, 2006;
(Fig. 7).EstimationofmarkersorderanddistanceofLG10 Morant et al. 2007). On the other hand CYP98A35 from
were improved with the integration of the co-dominant coffee is capable of metabolizing p-coumaroylquinate and
SNP-C30H markers, increasing the number of bridge p-coumaroylshikimate with the same efficiency (Mahesh
markers. The relative orders of some markers previously et al. 2007). CYP98A49 from globe artichoke appears to
123
PlantCellRep(2009)28:963–974 971
LG 10 male LG b male LG a
p13/m61-08 0 0 p13/m61-08
FemaleLG a FemaleLG b
e37/m50-03 0 0 e37/m50-03 e35/m48-02 15 15 e35/m48-02
p45/m47-01 8 8 p45/m47-01
e37/m47-10 27 27 e37/m47-10
CELMS-04 29 29 CELMS-04
pGA/p45-04 16 16 pGA/p45-04
p12/m47-01 33 33 p12/m47-01
e37/m48-01 35 35 e37/m48-01
CELMS-04 22 22 CELMS-04
pGA/m60-02 27 27 pGA/m60-02
CLIB-04 33 33 CLIB-04 e37/m50-02 47 47 e37/m50-02
CELMS-20 36 36 CELMS-20
38 e35/m47-05
e35/m47-05 40 e35/m48-12 54 54 e35/m48-12
42 p12/m47-08
43 e36/m59-02
p12/m47-08 45 e38/m50-11 60 60 e38/m50-11
47 cyre5/m49-04
p45/m47-07 50 49 p45/m47-07
cyre5/m49-04 56 e35/m47-05 69 69 e35/m47-05
e36/m59-02 57 57 snpC3H
CELMS-39 58 58 CELMS-39 p45/m50-02 74 74 p45/m50-02
p13/m60-04 60 61 p13/m60-04
pp1425//mm5407--0015 6634 6673 pp1425//mm5407--0016 cyper43e565///mmm454799---000724 788901 8729 pcy4r5e/m5/m474-09-704
p45/m47-06 69 70 p45/m47-05 84 e36/m59-02
e38/m50-07* 74 74 e38/m50-07* snpC3H 89 89 CELMS-39
CELMS-39 92 92 p45/m47-05
e38/m50-08* 80 80 e38/m50-08* p45/m47-06 95
97 p45/m47-06
cyre5/m49-01** 84 84 cyre5/m49-01** p45/m47-05 99
Fig.7 Linkage group (LG) 10 of the globe artichoke varietal types previouslyreportedbyLanterietal.(2006)arepresentedtooneside,
‘RomanescoC3’(femaleparent,whiteLGsontheleft)and‘Spinoso and changed marker orders are indicated by dotted lines. Asterisks
diPalermo’(maleparent,grayLGsontheright).Intercrossmarkers indicate markers showing significant levels of segregation distortion
are shown in bold and are connected by a solid line. The LGs (singleasterisk0.1[PC0.05,doubleasterisk0.05[PC0.01)
show a lower affinity for quinate esters than shikimate This compound is then converted by HCT (Hoffmann
esters (Fig. 5), but the limited activity detected for shi- et al. 2003; Comino et al. 2007) to caffeoyl-CoA which is
kimate esters hampered an accurate evaluation of conjugated to quinic acid by HQT (Niggeweg et al. 2004)
enzymatic activity with quinate esters. activity,togive5-caffeoylquinicacid.
Shikimate esters are transient intermediates in the for- It has been long debated whether the HQT enzyme
mation of more oxygenated compounds such as lignin either directly acts on caffeoyl-CoA and quinic acid to
precursorsandchlorogenicacid.Twodistinctpathwayshave produce chlorogenic acid, or whether it synthesizes
been proposed for the synthesis of chlorogenic acid: (1) p-coumaroylquinate from p-coumaroyl-CoA and quinic
pathway from p-coumaroyl-CoA, involving first a trans- acid,whichisconvertedtochlorogenicacidbyC30H.Strong
esterification of this compound and quinic acid via supportforthefirstalternativehasbeenprovidedintomato,in
hydroxycinnamoyl-CoA:quinate hydroxycinnamoyl trans- whichsilencingoftheHQTgeneresultedina98%reduction
ferase (HQT) activity and then hydroxylation of p-cou- inthelevelofchlorogenicacid(Niggewegetal.2004).
maroylquinateto5-caffeoylquinicacid,catalyzedbyC30H; ThegeneencodingHCTinglobeartichokehasrecently
(2)pathwayinvolvingp-coumaroyl-CoAtrans-esterification been isolated (Comino et al. 2007). It is not clear, in this
with shikimic acid by means of hydroxycinnamoyl-CoA: stage, if there are other C30H genes and for this reason is
shikimate hydroxycinnamoyl transferase (HCT), then not yet possible to conclude what is the route involved in
p-coumaroylshikimate hydroxylation to caffeoylshikimate. the synthesis of chlorogenic acid in globe artichoke.
123
972 PlantCellRep(2009)28:963–974
Some CYP98 genes are expressed constitutively, while mapped. In order tomove toa crossingstrategy for breed-
others (particularly those involved in the stress response) ing,agreaterknowledgeofglobeartichokegenomewillbe
are inducible. A. thaliana CYP98A3 is constitutively essential.Inparticularitwillbeadvantageoustoestablisha
expressed and is upregulated by wounding (Schoch et al. framework of linkage relationships for reaching a better
2001). Phaseolus vulgaris CYP98A5 is inducible by knowledge of the genetic bases of the phenylpropanoid
treatment with either 3,5-dichlorosalicylic acid or 2,6-di- pathway. The linkage relationships we established for the
chloroisonicotinic acid (Basson and Dubery 2007), while globe artichoke CYP98A49 gene may thus represent an
the activity of Daucus carota 5-O-(4-coumaroyl)-D-qui- initial step in this direction (Fig. 7). The precision of both
nate/shikimate 30-hydroxylase could be greatly increased marker orderandinter-markerdistancesofLG10 hasbeen
by irradiation with blue/UV light (Ku¨hnl et al. 1987). In improvedwiththe integration of CYP98A49gene.
order to evaluate the changes of CYP98A49 expression Future effortsof ourresearch will go inthe direction of
levels in response to UV-C induction, we performed RT- studyingtheroleoftheCYP98A49geneinglobeartichoke
PCR experiments. We have shown in a previous work development, by means of forward genetic approaches,
(Moglia et al. 2008) that in globe artichoke the production and in the identification of QTLs associated with the pro-
ofdicaffeoylquinicacids,whicharepowerfulantioxidants, duction of phenolic compounds such as chlorogenic acid
can be induced upon exposure to UV-C, which suggests a and dicaffeoylquinic acids. Indeed we are proceeding to
role for these compounds in the protection of young leaf the construction of genetic maps based on F1 populations
tissue from reactive oxygen species generated by excess involving combinations between ‘Romanesco clone C3’
light.TheexpressionlevelofCYP98A49genewasstrongly with either cultivated as wild cardoon accessions; these
increased (greater than fourfold higher) in UV-C treated populations will allow comparative QTL mapping studies.
leaves, as compared to non-treated control leaves, thus
indicating not only activation in response to UV light, but Acknowledgments The authors kindly thank Harry Jonker (PRI)
for his excellent technical assistance. The authors kindly thank Dr.
likelyalsoaputativeroleofthisenzymeindicaffeoylquinic
Ullmann (Universite´ Louis Pasteur, Strasbourg) for providing the
acidaccumulation.
substrates of the reaction, p-coumaroylquinate and p-coumaroyl-
Transcription factors are important in the regulation of shikimate and for critical reading of the paper. The authors kindly
plant responses to environmental stresses. Most of cyto- thank Dr Nelson for providing CYP number to the new gene. The
authors kindly thank Prof G. Mauromicale and Dr R. Mauro for
chrome P450 genes induced by abiotic and biotic stresses
providingplantmaterial.AndreaMogliaacknowledgesMIUR,forits
containtherecognitionsitesofMYB,MYC,TGA-boxand
financial support.JulesBeekwilder wasfinancially supportedbythe
W-box for WRKY factors in their promoters (Narusaka EU 6th Frame FLORA project (2005-FOOD-CT-01730). Ric C. H.
et al. 2004). The sequence analysis of the upstream region DeVosacknowledgesinitialsupportfromtheCentreforBioSystems
Genomics, an initiative under the auspices of the Netherlands
of globe artichoke CYP98A49 gene revealed the presence
GenomicsInitiative(NGI/NWO).
of most of these regulatory regions (Fig. 4). Moreover,
the same kind of motifs was found in the promoter of
ArabidopsisCYP98A3(nottestedforUVresponse),which
References
ishomologoustotheglobeartichokeCYP98A49gene.Ina
previous work (Narusaka et al. 2004) the distribution
AbdulrazzakN,PolletB,EhltingJ,LarsenK,AsnaghiC,RonseauS,
of cis-acting elements in the regulatory region of P450 Proux C, Erhardt M, Seltzer V, Renou J, Ullman P, Pauly M,
ArabidopsisgenesactivatedinresponsetoUV-Cradiation, Lapierre C, Werck-Reichhart D (2006) A coumaroyl-ester-
3-hydroxylase insertion mutant reveals the existence of non
was analyzed. Interestingly, all the UV-induced P450s in
redundant meta-hydroxylation pathways and essential roles for
Arabidopsis share with the globe artichoke CYP98A49
phenolic precursors in cell expansion and plant growth. Plant
promoter the recognition sites of MYB, MYC and the Physiol140:30–48.doi:10.1104/pp.105.069690
binding site of WRKY factors (W-box). Therefore, it is AdzetT,CamarassaJ,LagunaCJ(1987)Hepatoprotectiveactivityof
polyphenolic compounds from Cynara scolymus against CCl4
possible that the cis-acting elements recognized by MYB,
toxicityinisolatedrathepatocytes.JNatProd50:612–617
MYC and WRKY transcription factors may regulate the
Basson A, Dubery I (2007) Identification of a cytochrome P450
expression of genes induced upon UV-C. cDNA (CYP98A5) from Phaseolus vulgaris, inducible by 3, 5-
The identification of the genetic basis of metabolite dichlorosalicylicacidand2,6-dichloroisonicotinicacid.JPlant
Physiol164:421–428.doi:10.1016/j.jplph.2006.02.006
variation in A. thaliana has been pioneered by Keurentjes
BoudetA(2007)Evolutionandcurrentstatusofresearchinphenolic
et al. (2006), by applying quantitative trait loci (QTL)
compounds. Phytochemistry 68:2722–2735. doi:10.1016/j.
analysesonalargemetabolomicsdataset.Thisapproach,if phytochem.2007.06.012
applied to crop species, may lead to the development of Brown J, Rice-Evans C (1998) Luteolin-rich artichoke extract
protects low density lipoprotein from oxidation in vitro. Free
informative genetic markers that could be exploited in
RadicRes29:247–255.doi:10.1080/10715769800300281
breedingprogramsaimedatincreasingthelevelofspecific
CantosE,EspinJ,Tomas-BarberanF(2001)Effectofwoundingon
phytochemicals.TheC.cardunculusgenomeisstillpoorly phenolic enzymes in six minimally processed lettuce cultivars
123
Description:yeast, in order to perform an enzymatic assay with p- coumaroylshikimate . Seeds of globe artichoke ('Concerto', Nunhems) were germinated on a