Table Of ContentLearning and Instruction 66 (2020) 101271
ContentslistsavailableatScienceDirect
Learning and Instruction
journalhomepage: www.elsevier.com/locate/learninstruc
Self-derivation through memory integration: A model for accumulation of
T
semantic knowledge
Patricia J. Bauera,∗,1, Alena G. Espositob,1, James J. Dalya
aDepartmentofPsychology,EmoryUniversity,USA
bDepartmentofPsychology,ClarkUniversity,USA
ARTICLE INFO ABSTRACT
Keywords: Semanticknowledgeaccumulatesthroughexplicitmeansandproductiveprocesses(e.g.,analogy).Thesemeans
Learning work in concert when information explicitly acquired in separate episodes is integrated, and the integrated
Memory representation is used toself-derive new knowledge. Wetested whether (a)self-derivation through memory
Memoryintegration integrationextendsbeyondgeneralinformationtosciencecontent,(b)self-derivedinformationisretained,and
Semanticknowledge (c) details of explicit learning episodes are retained. Testing was in second-grade classrooms (children 7–9
Self-derivation years).Childrenself-derivednewknowledge;performancedidnotdifferforgeneralknowledge(Experiment1)
andsciencecurriculumfacts(Experiment2).InExperiment1,childrenretainedself-derivedknowledgeoverone
week. In Experiment 2, children remembered details of the learning episodes that gave rise to self-derived
knowledge; performance suggests that memory integration is dependent on explicit prompts. The findings
support nomination of self-derivation through memory integration as amodel for accumulation of semantic
knowledgeandinformtheprocessesinvolved.
1. Introduction Accordingly, in Experiment 1, we examined retention of information
self-derived in the classroom; the stimuli were drawn from prior la-
Buildingasemanticknowledgebaseisamajortaskofdevelopment boratorystudies.InExperiment2,weexaminedmemoryfordetailsof
andeducation.Informationaccumulatesthroughdirectmeans,suchas theexplicitlearningepisodesuponwhichself-derivationdepends;the
reading, listening to classroom lessons, interacting with museum ex- stimuli were aligned with the children's science curriculum. Across
hibits, and so forth. Knowledge also expands through inferential pro- experiments, we compared self-derivation of new factual knowledge
cesses including analogy, deduction, and induction (Gentner, 1983, acrossgeneralandsciencedomains.
1989;Goswami,2011).Thesemeansworkinconcertwheninformation Self-derivation through memory integration is one member of a
that is explicitly acquired in one learning episode is integrated with broaderclassofinferentialprocesses,includinganalogy,deduction,and
informationexplicitlyacquiredinadifferentepisode,andthroughin- induction(Gentner,1983,1989;Goswami,2011).Theseprocessesare
ferentialprocessesoperatingoverthenewlyintegratedrepresentation, generallyrecognizedtobemajormechanismsofcognitivedevelopment
newfactualknowledgeisgeneratedorself-derived.Childrenages4–11 (Bauer, 2012; Gentner, 1983, 1989; Goswami, 2011; Siegler, 1989).
years(e.g.,Bauer,Blue,Xu&Esposito,2016a;Bauer&Larkina,2017; Self-derivationofnewfactualknowledgethroughmemoryintegration
Bauer & San Souci, 2010) and college students (e.g., Varga & Bauer, occurs when information newly learned in one episode (e.g., dolphins
2017a; 2017b) self-derive new factual knowledge through memory liveingroupscalledpods)isintegratedwithinformationnewlylearned
integration.Theyalsoretainself-derivedknowledgeovertime(Varga& in a separate, related episode (i.e., dolphins talk by clicking and
Bauer, 2013, 2017b; Varga, Stewart, & Bauer, 2016). Although self- squeaking). The integrated memory representation then supports pro-
derivation through integration has been examined in elementary ductive extension of knowledge, such as the answer to the question
classrooms(Esposito&Bauer,2017,2019),therehavebeennotestsof “How does a pod talk?” Although the information that pods talk by
whetherclassroomderivedfactualinformationisretainedoveradelay. clicking and squeaking was not explicitly provided in either learning
Moreover,littleisknownaboutmemoryforthedetailsoftheepisodes episode, it can be self-derived based on the integrated memory re-
of direct learning that serve as the foundation for self-derivation. presentation. The process is thus an interaction of episodic and
∗Correspondingauthor.DepartmentofPsychology,36EagleRow,EmoryUniversity,Atlanta,Georgia,30322,USA.
E-mailaddress:[email protected](P.J.Bauer).
1jointfirst-authorship.
https://doi.org/10.1016/j.learninstruc.2019.101271
Received12May2019;Receivedinrevisedform3November2019;Accepted8November2019
0959-4752/ © 2019 Elsevier Ltd. All rights reserved.
P.J.Bauer,etal. Learning and Instruction 66 (2020) 101271
semanticmemory(e.g.,Tulving,1972,1983):informationisexplicitly Furthersupportforself-derivationthroughmemoryintegrationasa
taughtinseparateepisodesoflearning,andnewsemanticcontentthat viablecandidatemodelforaccumulationofsemanticknowledgecomes
isnottiedtoaparticularepisodeisderived(seeBauer,Dugan,Varga,& from findings that performance on tests of the process relates to aca-
Riggins, 2019, for discussion). Critically, formation of an integrated demic achievement in both adults and children. For adults, self-deri-
memory representation is necessary for self-derivation. If participants vationthroughintegrationrelatestobothverbalSATscoresandcollege
aretaughtonememberofapairofrelatedfactsbutnottheother,they GPA(rs=0.40and0.27,respectively);measuresofretentionofnewly
donotself-derivenewknowledge.Thedifferencesinperformanceare self-derivedknowledgeoveroneweekpredictedacademicGPA2years
large when both members of the pair of related facts are provided later(r=0.34;Varga,Esposito,&Bauer,2019).ForstudentsinGrades
versusonlyonememberofthepair(Cohen'sdvalues0.928,1.007,and 1–3,self-derivationrelatestofinalassessmentsofreadingcomprehen-
1.787,for4-,6-,and8-year-oldchildren,respectively:Bauer&Larkina, sion (nationally standardized test; rs=0.61) and math performance
2017;seealsoBauer&SanSouci,2010). (classroomgrades;rs=0.44).InGrade3,self-derivationpredictsaca-
Among the broader class of inferential processes, self-derivation demic performance in math as measured by nationally standardized
throughmemoryintegrationisofspecialsignificancebecauseithasa end-of-coursetests(β=0.54;suchtestsarenotavailablepriortoGrade
numberoffeaturesthatmakeitaparticularlyviablecandidatemodel 3;Esposito&Bauer,2017).
for accumulation of semantic knowledge. Although other inferential These findings present a strong case that self-derivation of new
processes sharesomeofthesefeatures andthus couldinprinciplein- factual knowledge through memory integration is a potentially im-
formaccumulationofknowledgeacrosslearningepisodes,theirutility portantmechanismbywhichchildrenmayaccumulateknowledgeover
on the issue is limited (a) bythe stimuli used (e.g., arbitrary associa- time.However,therearethreeimportantunknownsabouttheprocess
tions never meant to be retained: e.g., Zeithamova, Dominick, & thathaveimplicationsforitssuitabilityasamodelforaccumulationof
Preston, 2012), or (b) because the newly generated information is semanticknowledge.First,todate,therehavebeennotestsofwhether
evanescent (e.g., anaphoric reference: inferences survive in working facts newly self-derived in the classroom are retained over time.
memory only long enough to ensure comprehension; McKoon & Although robust retention is apparent in the laboratory, it cannot be
Ratcliff,1992).Incontrast,self-derivationthroughmemoryintegration assumed that it also would be observed in the classroom, based on
is tested using true, factual knowledge, retention of which would be differencesintheconditions ofencoding andtests ofretrieval. In the
beneficial to achievement. Consistent with this characterization, one laboratory,childrenexperienceadiscreteepisodeoflearninginaun-
importantfeatureofself-derivationthroughmemoryintegrationisthat ique,distinctivecontext,whichitselfmayserveasaretrievalcueatthe
factsderivedfromintegratedepisodesarerapidlyincorporatedintothe retention test (e.g., Bauer, Stewart, White & Larkina, 2016b). In con-
knowledgebase,asrevealedbyevent-relatedpotentials(ERPs;Bauer& trast, in the classroom, children experience multiple hours of instruc-
Jackson, 2015). Based on a single 400ms presentation, adults’ ERP tion in a row, increasing the likelihood of interference. As well, the
responsestofactsthatcouldbederivedfromintegratedepisodes(i.e., environmentoftheretentiontestdoesnotdifferentiallycuethetarget
“integrationfacts”)wereintermediatebetweenERPresponsestofacts learningepisoderelativetoallotherepisodesoflearninginthesame
that were entirely novel and facts that were well known. Based on a context (i.e., cue-distinctiveness is lacking: e.g., Bjork & Richardson-
second400mspresentation,ERPresponsestointegrationfactswereno Klavehn,1989;Herz,1997;Jacoby&Craik,1979;Smith,1988).Asa
longer distinguishable from responses to well-known facts; ERP re- consequence, there is reason to question whether factual information
sponses to both integration and well-known facts were different from newlyself-derivedintheclassroomissufficientlyrobusttoberetained
thosetonovelfacts(partialeta-squaredfordifferentcomponentsofthe andsufficientlyaccessibletoberetrieved.Thisisaparticularconcern
ERP waveforms ranged from .188 to .358; Bauer & Jackson, 2015). consideringthatperformanceisnominallylowerintheclassroomthan
Thus facts derived through integration rapidly transition to being inthelaboratory.Accordingly,thefirstpurposeofthepresentresearch
treatedas“wellknown.” was to test retention over a 1-week delay of facts self-derived in the
Anotherfeatureofself-derivationthroughmemoryintegrationthat classroomthroughmemoryintegration(Experiment1).
makesitanespeciallyviablecandidatemodelforaccumulationofse- The second missing element that bears on the suitability of self-
mantic knowledge is that the products of self derivation—new fact- derivationthroughmemoryintegrationasamodelforaccumulationof
s—are retained over time, at least when tested in the laboratory. semantic knowledge is whether the process extends to academic con-
Children as young as 4 and 6 years as well as adults remember self- tent. Thus far, the materials used in the classroom have been stimuli
derivedfactsforatleastoneweek(Varga&Bauer,2013,2017b;Varga developed for laboratory testing. They are true facts selected to be
et al., 2016). Levels of retention are high, with little to no forgetting previously unknown to and engaging for children (e.g., the Snickers®
overthedelay.Forexample,6-year-oldsself-derivednovelintegration candy bar is named after a horse). In the present research, across
factson63%oftrials.Oneweeklater,theyrecalled60%ofthefacts; Experiments 1 and 2, we compared self-derivation of new factual
the mean levels of performance did not differ from one another (eta- knowledge through integration using typical laboratory stimuli
squared0.007:Varga&Bauer,2013). (Experiment 1) to self-derivation when the stimuli were facts aligned
Self-derivation through memory integration as a model for accu- with the elementary science curriculum (Experiment 2). We used la-
mulation of semantic knowledge also is supported by the observation boratory-basedstimuliinExperiment1becausetheyarethestimulifor
that it occurs inelementary school classrooms. In Esposito andBauer whichretentionhasbeendemonstratedinthelaboratory(e.g.,Varga&
(2017),studentsinGradesK-3(ages5–10years)werepresentedwith Bauer, 2013). In Experiment 2, we used the science curriculum both
separate yet related episodes of new learning within their classrooms because of its importance to overall educational success (Newcombe,
(see also Esposito & Bauer, 2019). The episodes were story passages, Ambady,Eccles,Gomez,Klahr,Linn,etal.,2009),andbecausescience
each80–90wordsinlength.Ineachstory,acharacter(e.g.,Ladybug) instruction tends to be cumulative and thus, theoretically, should be
engaged in an activity during which it learned a true but novel fact. especially dependent on integration across related learning episodes.
Laterinthesameclassroomsession,studentsweretestedforself-deri- Giventhatlaboratorystudieshaveusedarangeofstimuli,andnosti-
vation of new facts based on memory integration. Although in the mulus-set differences have been found, we expected comparable per-
controlledlaboratoryenvironment,childrenasyoungas4yearsshow formanceacrossthetwotypesofstimuli.
evidence of self-derivation (e.g., Bauer & Larkina, 2017; Bauer & San Thethirdmissingelementthatbearsonthesuitabilityofself-deri-
Souci,2010;Vargaetal.,2016),kindergartenstudentsexhibitedfloor vationthroughmemoryintegrationasamodelofaccumulationofse-
levels of performance. In contrast, students in Grades 1–3 performed manticknowledgeiswhetherchildrenrememberdetailsoftheepisodes
well,thoughnominallylowerthantheircounterpartstestedinthela- in which novel, to-be-integrated facts are conveyed. Clearly, students
boratory(e.g.,Baueretal.,2016a;Bauer&Larkina,2017). remember information taught to them in the classroom. They even
2
P.J.Bauer,etal. Learning and Instruction 66 (2020) 101271
incorporate misinformation, such as incorrect facts, into their recall processmostlikelyoccurredatthetimeofencoding.
(e.g., Butler, Dennis, & Marsh, 2012). In both the laboratory and InExperiment2,wetested students forself-derivation ofnewsci-
classroom,childrenhavebeenfoundtorememberthefactsthatconvey enceknowledgethroughintegrationintheclassroom.Oneweeklater,
thespecificinformationthat,whenintegrated,servesasthefoundation we tested whether they remembered specific details of the explicit
for self-derivation (i.e., stem facts; e.g., dolphins live in groups called episodes of instruction, by comparing their recognition of statements
pods;dolphinstalkbyclickingandsqueaking).Stem-factrecallisrelated thatwere(a)presentedinoneortheotherofapairofrelatedepisodes
toself-derivationsuchthatchildrenwhohavehighlevelsofself-deri- (“old”), (b) not presented as part of any episode (“new”), and (c) a
vation also tend to have high levels of recall of related stem facts “hybrid” of information presented across a pair of related episodes.
(thoughtheconverseisnottrue;e.g.,Bauer&SanSouci,2010).Todate Endorsementofpreviouslypresentedstatementsas“old,”andrejection
there have been no tests of whether children also retain other in- of new statements, would indicate memory for the information sur-
formationfromtheepisodesinwhichstemfactsareembedded,suchas rounding the stem facts. We reasoned that endorsement of hybrid
themes,characters,andactivities.Norhastherebeeninvestigationof statementsas“old”wouldsuggestthatthechildrenhadintegratedthe
whethermemoryfordetailsofexplicitlearningepisodesisimpactedby episodes themselves, not only the stem facts featured therein. To ad-
thecognitiveoperationofintegration.Memoryforepisodedetailswas dressthepossibilitythatchildrenmightendorsehybridstatementsout
testedinExperiment2. ofconfusion(sincetheyweretechnically“new”yetcomprisedof“old”
Whetherchildren accurately retaindetailsofexplicit learningepi- information), we also evaluated children's confidence in their en-
sodes isan important question inits own right. Wetypically thinkof dorsements.Ifhybridstatementsinducedconfusion,childrenshouldbe
learning episodesasthesourceofnewsemantic orworldknowledge. lessconfidentinendorsingthem,relativetoendorsingoldstatements
Yet they also can serve an important function in episodic and, parti- andrejectingnewstatements.
cularly, autobiographical memory (e.g., Bluck, Alea, Habermas, & Thesitesforthepresentresearchweresecond-gradeclassroomsina
Rubin,2005).Thatis,individualsrememberspecificlearningepisodes small,ruraltownintheSoutheasternUnitedStates.Weselectedsecond
as sources of life lessons that they use to direct ongoing and future grade,withchildren7–9yearsofage,becauseinpriorresearch,chil-
activity(e.g.,Pillemer,2003;Waters,Bauer,&Fivush,2014). dren of this age have performed well on the task of self-derivation
Thequestionofwhetherchildrenaccuratelyretaindetailsofexplicit throughintegration(e.g.,Esposito&Bauer,2017,2019).Thismakesit
learning episodes also bears on whether the process of cross-episode likelywewouldavoidfloorperformancewhentestingretentionofself-
integration extends beyond the stem facts, to the balance of the in- derivedinformationovera1-weekdelay.Childrenofthisagealsohave
formation surrounding them (i.e., episode themes, characters, activ- relativelyhighlevelsofmemoryforthesourceofinformationtowhich
ities).Thisissueisoftheoreticalsignificanceforatleastthreereasons. theyhavebeenexposed(e.g.,Cycowicz,Friedman,Snodgrass,&Duff,
First, it could be expected to impact memory for the source of in- 2001; Riggins, 2014). This is important in order that endorsement of
formation. If integration extends beyond the individual facts to the hybrid statements in Experiment 2 would most likely be the result of
largerepisodesinwhichtheyareembedded,thenitwouldbedifficult cross-episode integration, as opposed to difficulty making source at-
to accurately remember the sources of explicitly taught information tributions.
(see Butler et al., 2012, for a related argument). The second, related In summary, in two experiments, we examined 7- to 9-year-old
reasonisthatformationofintegratedepisodes,withattendantlossof children's retention of information experienced in the context of tests
contextual(source)information,wouldleadtorapidtransitionofspe- forself-derivationthroughintegration.InExperiment1,wetestedre-
cificepisodestosemanticmemories(asobservedinBauer&Jackson, tention after one week of facts self-derived through integration of se-
2015).Thistransitiontypicallyisassumedtooccurasaresultofgen- parate yet related episodes of new learning. Based on laboratory re-
eralization over multiple episodes (e.g., Rogers & McClelland, 2004). search with 6-year-olds (Varga & Bauer, 2013), we expected the
Theimplicationisthat,inthecaseofintegratedepisodes,theprocessof children would retain newly self-derived facts over the delay. In Ex-
“episodic”memoriestransitioningto“semantic”memoriescouldoccur periment2,wetestedretentionafteroneweekofother,non-stem-fact
onthebasisofasingleexperience. informationfromtheepisodesinwhichstemfactswereconveyed.We
Thethirdreasonitisimportanttodeterminewhethertheprocessof expectedthatchildrenwouldaccuratelyrecognizeinformationthathad
integrationextendstotheentirelearningepisodeisbecauseitbearson beenpresentedintheepisodesandcorrectlyrejectinformationthathad
when integration occurs. Based on studies using ERP and fMRI, it ap- not been presented. If children integrated the separate episodes, they
pears that adults integrate memory representations at the time of en- should accept statements that were a “hybrid” of the separate yet re-
coding.InVargaandBauer(2017a),forexample,distinctiveERPpat- lated episodes of new learning. Finally, across experiments, we com-
ternswereobservedatencodingontrialsonwhichadultssubsequently pared self-derivation of content that was not (Experiment 1) and was
self-derivednewfactualknowledgethroughintegrationversustrialson (Experiment2)alignedwiththesecond-gradesciencecurriculuminthe
which they failed to self-derive (partial eta-squared=.83; see e.g., school system in which the work took place. We expected to observe
Zeithamova et al., 2012, for consistent evidence based on fMRI). In self-derivation for both types of stimuli, thus demonstrating the gen-
contrast, in children, the processes supporting self-derivation through eralizabilityoffindingsfromthelaboratorytoclassroomcurricula.
memory integration seemingly occur on demand, at the time of test.
Thissuggestionisbasedonfindingsthatwhenadelayisimposedbe- 2. Experiment1
tweenencodingofstemfactsandtestforself-derivation,performance
fallssubstantially.Delayisnottheculprit:ifthedelayisimposedafter 2.1. Method
the test for self-derivation, new knowledge is well retained (Varga &
Bauer,2013).Thispatternimpliesthatabsentthepromptordemandto 2.1.1. Participants
integrate and self-derive, children did not engage in the process (see The participants were 96 (56 female) students in second grade
also Bauer, King, Larkina, Varga, & White, 2012; and Bauer, Varga, classrooms in the same school in a public school system (M=8.11
King, Nolen, & White, 2015, for consistent evidence). Ifthis is an ac- years; range=89–109 months). Consent forms were sent home
curate depiction, then we would not expect to find evidence of in- through parent folders (the typical means of communication between
tegration unless there is a demand for it. In the self-derivation para- theschoolsystemandstudents’parents/guardians).Onlythedatafrom
digm,thereisademandtointegratethestemfacts(i.e.,itisprompted childrenwhoseparents/guardiansreturnedsignedconsentformswere
byaquestion,suchas,Howdoesapodtalk?),butthereisnodemandto included in analyses (approximately 39% of the population). The
integrate the larger episode in which the stem facts were embedded. sample was thus the population of children for whom parents/guar-
Thus if there is evidence of integration of non-stem-fact content, the dianshadprovidedconsentforuseoftheirdata.Basedontheresultsof
3
P.J.Bauer,etal. Learning and Instruction 66 (2020) 101271
priorresearchinwhicheffectsizesof0.3(andgreater)havebeenob- later,childrenweretestedformemoryfortheintegrationfacts.Testing
served(e.g.,Bauer&Larkina,2017;Varga&Bauer,2013),asampleof was conducted one-on-one by one of seven undergraduate research
45 would provide adequate power (0.8) for the planned repeated assistants.Allassistantshadbeenextensivelytrainedtoadministerthe
measuresdesign.Thusthestudyissufficientlypowered. protocolinthesamemanner.Fidelityofadministrationwasassuredby
Reflectingthediversityofthecommunity,basedonparentalreport, oneoftheauthors,whomonitored theassistantsthroughoutprotocol
thesamplewas38%African-American,29%Caucasian,22%Hispanic/ administration. There were no protocol errors on the measure of in-
Latinx, 9% multiracial, and 2% unreported. Eighty-four percent of terestinthepresentresearch.
children in the community qualify for federally funded school lunch
assistance. Of the 82 participants whose families reported caregiver 2.1.3.1. Session 1. The 45-min classroom sessions were divided into
education, 35% had a high school education or less, 28% had some threephases.InPhase1,childrenheardthefirstmemberofeachofthe
trainingbeyondhighschool,15%hadatechnicalorassociatesdegree, fourpairsoftextpassages(i.e.,onepassageeachaboutcats,theQueen
16% had a college bachelor degree, and 6% had education beyond a of England, apricots, and Snickers®). Children then engaged in an
college degree. Participating teachers were thanked with a $20 gift unrelatedbufferactivityforapproximately10min.Phase2commenced
card, parents were thanked with a $10 gift card, and participating afterthebufferactivity.Thechildrenheardthesecondmemberofeach
children were thanked with a small school supply item (e.g., eraser). stem-fact passage pair (i.e., the second passage each about cats, the
The Institutional Review Board and the School Board of the partici- QueenofEngland,apricots,andSnickers®).FollowingPhase2,children
pating school system reviewed and approved all study protocol and engaged in a second 10min buffer activity. For both phases, the
proceduresforthisandthesecondexperiment. illustrations conveying the main actions of the passages were
projected onto the classroom screen (approximately 4′ by 6’). The
2.1.2. Stimuli pre-recordedaudiotrackswereplayedthroughspeakers.Theslidesand
Thestimuliwereeightnovel“stem”facts,eachofwhichwasatrue audiowereadvancedautomatically,ensuringconsistenttimingacross
fact.Theeightstemfactsformedfourpairssuchthat,withinapair,the classrooms. The text passages within domains were counterbalanced
twofactswererelatedandcouldbecombinedtogenerateanovelin- and domains were presented in one of four pre-determined random
tegration fact. Onepair ofstem factswasthat(a) tigersarethe largest orders; each order was used approximately equally often across
cats,and(b)thelargestcatsswimtocooloff.Thesefactscouldbecom- classrooms.
binedtosupportself-derivationofthenewknowledgethattigersswimto In Phase 3, children were tested for self-derivation of new factual
cooloff.Thestimuliwerepilottestedtoensureboththatthestemand knowledgethroughintegrationofthemembersofthepairsofrelated
integrationfactswerenoveltochildreninthetargetagerangeandthat stemfacts,firstinopen-endedandtheninforced-choiceformat.Both
bothstemfactswerenecessaryforproductionoftheintegrationfacts. open-endedandforced-choiceformatswereusedtoguardagainstpo-
Pilottestingwasconductedinthelaboratoryinsmallgroupstomimic tential floor effects in open-ended testing and thus ensure adequate
theconditionsoftestingintheclassroom. variability for analyses. Children also were tested for recall (open-
The stem facts were featured in text passages resembling picture ended)andrecognition(forced-choice)ofthestemfacts.Forexample,
stories. The passages were 81–89 words in length, distributed over 4 to test self-derivation of integration facts in open-ended format, chil-
pages.Eachpagefeaturedahand-drawnillustrationdepictingthemain drenwereposedthequestion“Whatdotigersdotocooloff?”(which
actionsofthetext;thetextwasnotincludedonthepage.Forexample, couldbeansweredthroughintegrationofthestemfactfromthesample
thestoryofthe“ContestoftheCats”wasrenderedas(thestemfactis passageabove[tigersarethelargestcatsintheworld]withthestemfact
indicatedinitalics): inthepairedpassage,notpresented[thelargestcatsintheworldswimto
cool off]). In forced-choice format, they were presented the same
Page1.Frogknewthattherearemanylargecatsintheworld.One questionalongwiththreechoicealternatives,oneofwhichwascorrect:
day,sheheldacontesttofindoutwhichcatwasthebiggest. (a)swim,(b)shower,(c)sleep.Totestopen-endedrecallofstemfacts,
Page2.Frogwasthejudge.Eachtypeofcatlinedupsoshecould childrenwereposedthequestion“Whatisthelargestcatintheworld?”
seetheirsizes. Inforced-choiceformat,theywerepresentedthesamequestionalong
Page3.Thereweremanybigcats,butthetigerwasthelargestcatin withthreechoicealternatives,oneofwhichwascorrect:(a)jaguars,(b)
theworld.Froghappilyannouncedthewinnertoeveryone. tigers,(c)cheetahs.
Page4.ThecontestwascompleteandnowFrogknewthattigersare All questions were read aloud by a researcher. For open-ended
thelargestcatsintheworld. testing,childrenrecordedtheirresponsesonananswersheet.Theyfirst
weretestedforself-derivationoftheintegrationfacts,followedbyre-
Allofthepassagesweresimilarinstructure:acharacterlearneda call of the stem facts. After open-ended testing, children were given
true but novel factinthecourse ofa shortstory. Each passage hada response devices (i.e., “clickers”) to record their answers to 3-alter-
differentanimalasthemaincharacter.Eachpairofpassageswasdrawn native forced-choice questions (one correct alternative and two dis-
from a different domain: cats, the Queen of England, apricots, and tracters; chance=33%). As in open-ended testing, the integration
Snickers®.ThestemfactswerepresentedonPage2or3ofthepassages questions were posed first, followed by the stem fact questions. The
and were repeated on the final page; the integration facts were not integrationandstem-factquestionswerepresentedinoneoffourpre-
presented.FollowingEspositoandBauer(2017),thetextpassageswere determinedrandomorders;eachorderwasusedapproximatelyequally
presentedindigitalbookformat.Eachillustrationwasscannedintoa oftenacrossclassroomsandtextpassageorders.
PowerPoint®slide.TheaudioportionswererecordedbyanativeEng-
lishspeaker. 2.1.3.2. Session 2. Approximately one week after the self-derivation
test, children were tested for recall followed by recognition of the
2.1.3. Procedure integrationfactstheywereexpectedtoself-deriveatSession1.Testing
Childrenparticipatedintwosessionsintheirschools,approximately tookplaceinadifferentclassroom.Becausethesetting,format,andtest
one week apart (M delay=6.19 days, SD=0.80). In Session 1, they administratorsweredifferentfromSession1,childrenfirstwereasked
were tested for self-derivation of new factual knowledge through in- two questions about the stories presented one week previously to
tegration of separate episodes. The protocol was administered in the remind them of the material in which we were interested; the
children'sclassroomstotheentireclass(approximately20–23children integration facts were not prompted. After the story-reminder
perclassroom).Onlythedatafromchildrenwhoseparents/guardians questions, children were asked open-ended questions testing recall of
returned signed consent forms were included in analyses. One week theintegrationfacts(e.g.,“Howdoesapodtalk?“),followedbyforced-
4
P.J.Bauer,etal. Learning and Instruction 66 (2020) 101271
choicetestingiftheyfailedtoproduceacorrectopen-endedresponse(3
alternatives; chance=33%). The forced-choice alternatives were the
sameasthoseusedatSession1.
2.1.4. Scoring
AtSession1,childrenreceived1pointforeachcorrectresponsetoa
self-derivationquestion,foratotalpossiblescoreof4ineachofopen-
ended and forced-choice testing of the integration facts. They could
score up to 8 in each of open-ended and forced-choice testing of the
stem facts (i.e., 2 stem facts for each integration fact). At Session 2,
childrenreceived1pointforeachintegrationfactrecalledand1point
for each additional integration fact recognized in forced-choice. Thus
childrencouldscoreupto4pointsforrecallinopen-endedtestingand
4pointsfortheirtotalscore(open-endedrecallplusadditionalunique
itemsinrecognition).
2.2. Results
The results are presented in three sections: (a) self-derivation of
integration facts and stem-fact memory performance at Session 1, (b) Fig. 2.Number of integration facts recalled (open-ended) and recalled and
recallandrecognitionoftheintegrationfactsoneweeklateratSession recognized(combinedtotal)atSession2inExperiment1.
2,and(c)relationsbetweenself-derivation(andstem-factmemory)and
latermemoryfortheintegrationfacts. integrationfactsonameanof1.95(SD=1.12)trials(max=4).This
represents a statistically significant increase in performance from Ses-
2.2.1. Self-derivationandstem-factmemoryatsession1 sion 1 by a mean of 0.42, 95% CI[0.21 to 0.62], t(95)=4.03,
ThedistributionofscoresatSession1isdepictedinFig.1.Inopen- p < .001,d=0.40.Fortrialsonwhichthechildrendidnotrecallthe
endedtesting,childrenself-derivedtheintegrationfactsonameanof integrationfacts,theyweregiventheopportunitytochoosethecorrect
1.53trials(SD=1.06;max=4)andtheyrecalledthestemfactsona answerfromamongdistractors.Childrenrecognizedameanofanad-
meanof4.56trials(SD=2.00;max=8).Onthebalanceofthetrials, ditional1.57(SD=0.86)integrationfacts,foratotalcombinedrecall/
children indicated that they “didn't know” or left the answer sheet recognition score of 3.45 (SD=0.88; max=4). Thus students suc-
blank; they rarely provided a content response that was incorrect. In cessfullyretainedtheinformationoverthe1-weekdelay.Indeed,con-
forced-choicetestingofintegrationfacts,childrenselectedthecorrect sistent with findings from laboratory-based research (Varga & Bauer,
answers from among distracters on a mean of 3.27 trials (SD=0.95; 2013),therewasnolossofinformationoverthedelay.
max=4)andtheyselectedthecorrectanswerstothestem-factques-
tions on a mean of 6.78 trials (SD=1.67; max=8). For both in- 2.2.3. Relationsbetweenstem-andintegration-factperformanceandlater
tegration and stem facts (0.82 and 0.85, respectively), forced-choice memory
accuracy was significantly above chance (0.33) for a mean differ- Table 1 summarizes the correlations between self-derivation per-
ence > 0.49,95%CIs[0.44to0.56],t(95)s > 20.21,ps < .001.Thus formance in open-ended and forced-choice testing formats and recall
thechildrenwererelativelysuccessfulatthetask. and recognition of the stem facts (open-ended, forced-choice, respec-
tively) at Session 1, and their predictive relations with recall and re-
2.2.2. Recallandrecognitionofintegrationfactsatsession2 cognition oftheintegration factsatSession2.Therewasaconsistent
One week after the test for self-derivation of integration facts, pattern of positive relation among the variables. Two aspects of the
childrenhadhighlevelsofrecallandrecognitionofthem,asdepicted interrelationsareespeciallynoteworthy.First,asobservedinpriorre-
in Fig. 2. In open-ended testing, children recalled the self-derived search (Bauer & San Souci, 2010), within Session 1, open-ended self-
derivationwasrelatedtorecallofthestemfacts(r=0.66).Thesame
relationwasobservedwhenbothself-derivationandstemfactmemory
weretestedusingforced-choice(r=0.58).Theserelationsaredepicted
in Appendix A, Figure A.1, Panel A. Second, performance at Session
1—bothself-derivationandstem-factmemory—waspredictiveofrecall
andrecognitionofself-derivedknowledgeatSession2.Thecorrelations
amongthemeasuresrangedfrom0.44to0.57.AppendixA,FigureA.2,
Panel A provides depictions of the most prominent of these relations
(between open-ended self-derivation of integration facts and recall of
stem facts at Session 1 and open-ended recall and total memory for
integration facts at Session 2). R2 values indicate that self-derivation
and stem-fact memory at Session 1 accounted for between 19% and
32%ofthevarianceinretentionofself-derivedknowledgeoverthe1-
weekdelay.
2.3. Discussion
InareplicationofEspositoandBauer(2017),second-gradestudents
Fig. 1.Number of integration and stem facts produced in open-ended and self-derivednewfactualknowledgethroughintegrationofseparateyet
forced-choicetestinginExperiment1.Thedashedlinesinforced-choicetesting related episodes of new learning in their classrooms. The present re-
indicatethelevelofperformanceexpectedbychance. searchalsoextendedpriorresearchbytestingretentionfromclassroom
5
P.J.Bauer,etal. Learning and Instruction 66 (2020) 101271
Table1
Pearsoncorrelationsamongmeasuresofself-derivationperformanceandstem-factmemoryinexperiment1.3
learningthroughintegration.Theresultswereclear:childrenhadhigh 2.4. Experiment2
levels of recall and recognition of their self-derived knowledge one
weeklater.Indeed,performanceafterthe1-weekdelaywasstatistically Experiment 2 had two major purposes. First, to evaluate self-deri-
higher than performance at Session 1. The findings thus demonstrate vationthroughmemoryintegrationasamodelforclassroomlearning,
thatproductiveextensionofknowledgethroughmemoryintegrationis we used stimuli that were generated from the state standards for
aviablemodelforaccumulationofknowledgenotonlyinthelabora- second-gradesciencecurriculuminthehostschoolsystem.Thestimuli
tory(e.g.,Bauer&Larkina,2017),butintheclassroomaswell. were generated from material that had not yet been covered in the
Theresultsofthepresentstudymakeclearthatchildrenremember classroom. All other conditions of testing for self-derivation through
informationtheythemselvesself-derived,throughintegrationofsepa- integrationwerethesameacrossexperiments.
rate yet related episodes of new learning. Successful self-derivation The second major purpose of Experiment 2 was to test whether
dependsonformationofamemoryrepresentationthatistheintegra- childrenrememberdetailsoftheexplicitlearningepisodesinwhichto-
tionofseparatestoryepisodes(Bauer&Varga,2017).Thisraisesthe be-integrated stem factsareconveyed. Thisquestion stands to inform
questionoftheconsequencesofintegrationformemoryoftheepisodes whethercross-episodeintegrationextendsbeyondthestemfactstothe
themselves. It is possible that integration extends to the episode as a episodicinformationsurroundingthem.Toensurearobusttestofthe
whole, creating a representation that is a blend or hybrid of the in- question, in a between-subjects manipulation, we used two different
dividualepisodesonwhichitisbased.Inthiscase,childrenmayfailto levelsofsurface-featuresimilarity:(a)highsurface-similarity,inwhich
distinguishstatementsthatwereactuallypresentedinthestoriesfrom thetwopassagesinapairhadthesamemaincharacter(e.g.,alizardin
statementsthatwereneverpresented,butwhichincorporateelements both passages); and (b) low surface-similarity, in which the passages
from both stories. Alternatively, it is possible that integration is re- withinapairhaddifferentmaincharacters(e.g.,alizardinonepassage
strictedtothestemfactsthemselvesanddoesnotextendtotheepisode andacatintheother).Wereasonedthatthesamecharacteracrossthe
asawhole.Inthiscase,wewouldexpectpreservationofdistinctepi- twopassagesmightmakeitmorelikelythatintegrationwouldextend
sode boundaries, permitting children to distinguish statements that beyond the stem facts to the entire story episodes, whereas different
wereactuallypresentedinthestoriesfromstatementsthatwerenever charactersmightmakeitmorelikelythattheseparateepisodeswould
presented,evenifthosenewstatementsare“hybrids”createdfromthe remaindistinct.
pairofepisodes.WetestedthesecompetingpossibilitiesinExperiment
2. We used as stimuli facts derived from the children's science curri- 2.5. Method
culum,thuspermittingabetween-experimentcomparisonofself-deri-
vation through integration when stimuli were based on those used in 2.5.1. Participants
the laboratory (Experiment 1) with self-derivation when the stimuli The participants were 103 (46 female) children in second grade
werealignedwiththeelementarysciencecurriculum(Experiment2). (M=8.17 years; range=91–112 months). The children were drawn
fromthesamepopulationasExperiment1.Testingwasconductedtwo
6
P.J.Bauer,etal. Learning and Instruction 66 (2020) 101271
years after Experiment 1, and none of the children had taken part in throughintegrationofseparateepisodesinSession1.Oneweeklater,
Experiment1.TheconsentprocedurewasthesameasinExperiment1. theyweretestedforrecognitionofthreedifferenttypesofstatements.
Onlythedatafromchildrenwhoseparents/guardiansreturnedsigned
consent forms were included in analyses (approximately 41% of the 2.5.3.1. Session 1. The Session 1 protocol was the same as in
population). As was the case in Experiment 1, the result was a popu- Experiment 1. Although the protocol was administered to the entire
lation sample. As discussed in Experiment 1, the study is sufficiently class, only the data from children whose parents/guardians returned
powered:asampleof45wouldprovideadequatepower(0.8)forthe signedconsentformswereincludedinanalyses.
plannedrepeatedmeasuresdesign.
Reflectingthediversityofthecommunity,basedonparentalreport, 2.5.3.2. Session 2. Approximately one week after presentation of the
thesamplewas37%African-American,31%Caucasian,20%Hispanic/ stem-factstoriesandthetestforself-derivation,childrenweretestedfor
Latinx, 5% multiracial, 1% American Indian/Alaska Native, and 6% recognitionof24statementsrelatedtothestorypassages.Onethirdof
unreported. Of the 95 participants whose families reported caregiver the statements (n=8) were taken verbatim from one of the story
education, 46% had a high school education or less, 22% had some passages; half of the statements were from each passage in a pair of
trainingbeyondhighschool,13%hadatechnicalorassociatesdegree, relatedpassages.Totheextentthatthechildrenrememberedthestory
and 19% had a college bachelor degree. Children participated in two passages, they were expected to indicate that they had heard these
sessions approximately one week apart (M delay=7.23Days, statementsbefore(i.e.,toindicatethattheywere“old”).Onethirdof
SD=0.96).Participatingparents,teachers,andchildrenwerethanked the statements (n=8) were entirely new. To the extent that the
asinExperiment1. children remembered the story passages, they were expected to
indicate that they had not heard these statements before (i.e., to
2.5.2. Stimuli indicate they were “new”). The remaining one third of statements
As in Experiment 1, the stimuli were novel facts. Related pairs of (n=8)werehybridscreatedbycombiningelementsofthetwostory
facts could be integrated with one another and serve as the basis for passagesinapair(seeFig.3).Ifchildrenmaintainedtheboundariesof
self-derivationofanovelintegrationfact.Thestemfactswerederived theepisodesevenafterintegratingthestorypassageinformation,they
from domains covered in the children's science curriculum: matter, wereexpectedtoindicatetheyhadnotheardthesestatementsbefore
sound,space,andlifecycles.Thespecificfactshadyettobecoveredin (i.e., to indicate they were “new”). However, if integration extended
theclassroom.Priortotheiradministrationintheclassroom,thefacts beyond the stem facts to the entire episodes, resulting in a blended
werepilottestedtoensureboththeywereunknowntochildreninthe representation, then because these statements featured content from
target age range, and that exposure to both members of the pairs of both stories, children were expected to indicate that they had heard
relatedstemfactswasnecessaryforgenerationoftheintegrationfacts. thesestatementsbefore(i.e.,toindicatetheywere“old”).
AsinExperiment1,thestemfactswerefeaturedinillustratedtext Childrenweretoldthat“Lastweek,youheardsomestoriesinyour
passages81to89wordsinlength,distributedover4pages;thetextwas classroom.IamgoingtoreadyousomesentencesandIwantyoutotell
notfeaturedonthepage.Totestwhetherthesurfacesimilarityofthe meifyouheardthisinformationinthestorieslastweek.”Testingwas
passages impacted preservation of distinct episodic features, for ap- forced-choice, with two alternatives: thechild endorsed having heard
proximatelyhalfofthechildren(n=43),thetwopassagesinapairhad the statement in the context of the story passage paradigm one week
the same animal as the main character, and for the other half of the earlierorthechildhadnotheardthestatement.Aftereachtrial,chil-
children(n=60),thetwopassagesinapairhaddifferentanimalsas drenwereaskedtorate“howsure”theywereoftheiranswerusinga4-
themaincharacters. pointLikert-typescale.Testingwasconductedone-on-onebyoneof12
As in Experiment 1, only the stem facts were included in the pas- research assistants (including one of the authors). All assistants had
sages;theintegrationfactswerenotpresented.AlsoasinExperiment1, beenextensivelytrainedtoadministertheprotocolinthesamemanner.
thetextpassageswerepresentedindigitalbookformat.Eachillustra- Fidelityofadministrationwasassuredbyanotheroftheauthors,who
tion was scanned into a PowerPoint® slide. The audio portions were monitored the assistants throughout protocol administration. There
recordedbyanativeEnglishspeaker. were no protocol errors on the measure of interest in the present re-
Wealsodeveloped24memorystimulitobeusedatSession2,8of search.
each of three types (see 3.2.3.). An illustration of each of the three
differenttypesofstimuliisprovided inFig.3.Onethirdofthestate- 2.5.4. Scoring
ments (n=8) were taken directly (verbatim) from one of the story At Session 1, children received 1 point for each correct response.
passages. There was one verbatim statement from each passage (thus Thustheycouldscoreuptoa4ineachofopen-endedandforced-choice
half of the statements were from each passage in a pair of related testingoftheintegrationfacts.Theycouldscoreupto8ineachofopen-
passages). One third of the statements were entirely new—they fea- endedandforced-choicetestingofthestemfacts.AtSession2,children
tured the same characters, themes, and settings as the stimulus story receivedonepointforeachstatementendorsedas“old”(max=8for
passages,buttheyhadnotbeenpresentedverbatimandneitherwere eachstatementtype:old,new,hybrid).Fortheconfidencescale,chil-
they“gist”representationsofstatementsinthestories.Thereweretwo drenreceivedascoreof0for“notsureatall,”1pointfor“alittlesure,”
newstatementsforeachstorypassagepair.Theremainingonethirdof 2pointsfor“mostlysure,”and3pointsfor“completelysure.”
statements were hybrids created by combining elements of the two
storypassagesinapair.Thatis,aportionofthestatementcamefrom 2.6. Results
Passage1(intheexampleinFig.5,PanelA:rocket)andaportionofthe
statementcamefromPassage2(forLizard'sbirthday,herdadgaveher). Theresultsarepresentedinthreesections:(a)self-derivationofthe
The two portions were combined to create a hybrid statement (e.g., integration facts at Session 1 and memory for the stem facts, (b) en-
Panel B: Lizard's dad got her a rocket for her birthday). Finally, we de- dorsement of statements as “old” at Session 2 and confidence in the
veloped aLikert-type scaletoassess children'sconfidence intheiren- endorsements, and (c) relations between self-derivation at Session 1
dorsements of the statements as “old” (see 3.2.3.). The scale was 4 andpatternsofandconfidenceinendorsementofstatementsas“old”at
points,with1indicating“notsureatall,”2indicating“alittlesure,”3 Session2.
indicating“mostlysure,”and4indicating“completelysure.”
2.6.1. Self-derivationandstem-factmemoryatsession1
2.5.3. Procedure Todeterminewhetherself-derivationthroughmemoryintegrations
Children were tested for self-derivation of new factual knowledge extends to classroom science content, we examined levels of self-
7
P.J.Bauer,etal. Learning and Instruction 66 (2020) 101271
Fig.3.Apairofrelatedepisodes(Passage1and
Passage2)presentedatSession1(PanelA)and
illustrations of each of three statement types
testedatSession2(PanelB),usedinExperiment
2. Information presented in bold in Passage 1
illustrates the verbatim statement type: the
statement was taken directly from one of the
passagesthechildrenexperiencedatSession1.
InformationpresentedinitalicsinPassages1and
2wascombinedtocreateahybridstatement:all
of the content in hybrid statements had been
presented in the passages; a portion of the
statement was presented in Passage 1 and a
portionwaspresentedinPassage2.Newstate-
mentswerenotrepresentedinthelearningepi-
sodes, but were thematically consistent with
them.
Table2 derivation of the integration facts and open-ended recall of the stem
Descriptive Statistics for Self-derivation and Stem-fact Performance in facts did not differ between the experiments, even though each used
Experiment2. entirely different stimuli, t(189)=0.22, p=.83, d=0.03, and t
(188)=−0.53, p=.59, d=0.08 (respectively). In forced-choice
TaskandTestingPhase
testing (PanelB), performanceinExperiment1wasnominally higher
IntegrationFacts StemFacts than in Experiment 2, though the difference did not reach statistical
significance, t(194)=1.93, p=.06, d=0.28. The difference in re-
Open- Forced- Open- Forced-choice cognition ofthestemfactswasstatistically significant,t(194)=5.01,
ended choice ended
p < .001, d=0.72, with higher performance in Experiment 1. This
Similaritycondition M(SD) M(SD) M(SD) M(SD) across-experiment comparison makes clear that children self-derive
Highsimilarity 1.59(1.29) 2.82(1.19) 5.00(1.93) 5.62(1.62) new knowledge through memory integration across a wide range of
Lowsimilarity 1.42(1.26) 3.09(0.88) 4.60(2.12) 5.45(1.88)
stimuli,includingmaterialsderivedfromthesciencecurriculum.Pos-
Overall 1.49(1.25) 3.00(1.02) 4.72(2.08) 5.52(1.84)
siblereasonsforlowerlevelsofforced-choiceselectionarediscussedin
Note: M refers to mean correct performance and (SD) refers to the standard Section3.4.
deviation. AsobservedinExperiment1,inthepresentexperiment,memoryfor
stemfactsandself-derivationthroughintegrationwerepositivelycor-
derivation in both open-ended and forced-choice formats, as well as related in both the open-ended, r(93)=0.79, p < .001, and forced-
recall and recognition of the stem facts. Statistics describing perfor- choice, r(98)=0.58, p < .001, testing formats. Depictions of these
mance in each of the similarity conditions, as well as overall (across relationsareprovidedinAppendixA,FigureA.1,PanelB.
similarityconditions),areprovidedinTable2.AMANOVAexamining
differences in self-derivation and stem fact performance revealed no 2.6.2. Testforrecognitionandconfidenceatsession2
difference in open-ended or forced-choice performance across the si-
To address the questions of whether (a) children remember in-
milarity conditions, F(92)=1.30, p=.28, η2=0.06. In light of the
formation from the larger episodes in which stem facts are presented
absence of difference between similarity conditions, we examined (patterns of endorsement of “old” and “new” statements), and (b) in-
forced-choice performance across the similarity conditions. For both
tegrationextendsbeyondthestemfactstotheentireepisodesinwhich
integration facts (0.75 correct) and stem facts (0.69 correct), forced- they are presented (patterns of endorsement of “hybrid” statements),
choiceperformancewassignificantlyabovechance(0.33)withamean
we conducted a 2 (surface similarity: high, low) x 3 (statement type:
difference > 0.36,95%CI[0.31to0.47],t(99)s > 15.61,ps < .001.
old,new,hybrid)mixedanalysis ofvariance, withrepeatedmeasures
Todeterminewhether self-derivation through memory integration
onstatementtype.Contrarytopredictions,patternsofendorsementdid
differedforscienceandnon-sciencecontent,wecomparedperformance notdifferasafunctionofwhetherthemembersofthestem-factpassage
inthepresentexperimentwiththatinExperiment1.Foreaseofcom- pairs had the same or different main characters (Fs<0.05, ps>.83,
parison, performance is depicted in Fig. 4 for both experiments. No- η2 < 0.001). In subsequent analyses, we collapsed across levels of
tably,assuggestedbyinspectionofPanelA,levelsofopen-endedself-
surfacesimilarity.
8
P.J.Bauer,etal. Learning and Instruction 66 (2020) 101271
children were significantly more confident in their judgments for old
statements than new or hybrid statements. Children also were sig-
nificantly more confident in accepting hybrid statements than new
statements.Thispatternisnotwhatwouldbeexpectedifchildrenwere
simply confused by the hybrid statements (in which case, their con-
fidencescoreswouldhavebeenlowestoverall).
2.6.3. Relationsbetweenself-derivationandendorsementofstatementsas
“old”andconfidencejudgments
Becauseself-derivationperformanceoneachofthefourtrialswas
nestedwithineachchild,weusedmulti-levelmodeling(MLM)totest
relations between self-derivation and stem-fact performance and en-
dorsement of statements as “old.” Multi-level modeling allows for in-
dividual intercepts and controls for the nesting of data within in-
dividuals. Specifically, it permits predictors at the level of the
individualtrialandattheleveloftheperson.Italsotakesintoaccount
theinterdependency ofmultiple observations per person(i.e., 4 trials
for each child), correcting for the biases in parameter estimates re-
sulting from dependency of the observations (Raudenbush & Bryk,
2002; Wright, 1998). Because confidence judgments also were nested
within each child, we used MLM to examine relations between chil-
dren'sconfidenceintheirjudgmentsandtheirpatternsofendorsement
ofthestatements.
2.6.3.1. Self-derivation and endorsement of statements as “old”. To
minimize the complexity of the analysis, we conducted separate
multi-level models for each statement type (old, new, hybrid; see
Table 3, Panel A, for unchanged null models). We first tested null
modelstodeterminewhethertherewasvarianceatbothlevelsofthe
model: Level 1 (trials) and Level 2 (individuals; e.g., Nezlek, 2001;
Raudenbush&Bryk,2002).Theresultsrevealedsufficientvarianceat
bothlevelsforallthreestatement types,with23%,21%,and31%of
variance between person for old, new, and hybrid statements
(respectively).ThefullanalyticapproachisdescribedinAppendixB.
Fig.4.Numberofintegrationfactsproducedandstemfactsrecalledinopen- Wenextexaminedwhetherself-derivationperformanceinSession1
endedtestinginExperiments1and2(PanelA)andnumberofintegrationfacts on each trial predicted endorsement for statements related to that
selected from among distracters and stem facts recognized in forced-choice specific trial. As reflected in Table 3, Panel B, self-derivation perfor-
testinginExperiments1and2(PanelB). manceaccountedforsignificantvarianceinendorsementofoldstate-
ments. That is, on trials on which children integrated the pairs of re-
AssuggestedbyinspectionofFig.5,PanelA,therewasamaineffect latedstories,asevidencedbysuccessfulself-derivation,theyweremore
ofstatementtype,F(2,100)=92.39,p < .001,η2=0.65.Follow-up likely to correctly endorse old statements as “old.” In contrast, self-
pairwise comparisons with Bonferroni corrections revealed significant derivationperformancedidnotaccountforsignificantvarianceinen-
differences in children's rates of endorsement of all three statement dorsementofneworhybridstatements.Thusonanygiventrial,whe-
types.Specifically,childrenmoreoftenindicatedtheyhadheardtheold therthechildrenintegratedthepairsofrelatedstories(asevidencedby
statements than both new and hybrid statements; hybrid statements successful self-derivation) was not related to the likelihood that they
wereendorsedathigherlevelsthannewstatements. wouldacceptneworhybridstatementsasold.
Analysesagainstchanceperformanceindicatedasystematicpattern
of endorsement of old statements, such that children responded that 2.6.3.2. Confidence judgments and endorsement of statements as
theyhadheardoldstatementsatalevelthatexceededchance(.50),t “old”. We also conducted analyses to determine whether children's
(102)=8.66, p < .001. The mean difference from chance was 0.20 confidenceintheirjudgmentsrelatedtotheirpatternsofendorsement
(95% CI[0.16 to 0.25]). In contrast, for both the new and hybrid of the statements. As in the previous analyses, to minimize the
statementtypes,childrenhadbelow-chancelevelsofendorsement,in- complexity, we conducted separate multi-level models for each
dicating accurate recognition that these statements hadnot been pre- statement type (old, new, hybrid). The null models were unchanged
sentedinthestories,ts(102)=7.36and3.61,ps < .001(respectively). fromabove(seeTable3,PanelA).
The mean differences from chance were −0.17 and −0.10 (95% CIs In all three models, confidence judgements were significantly and
[-0.21to−0.12]and[-0.14to−0.04],respectively. positivelyrelatedtoendorsementofthestatementtype(Table3,Panel
We also examined the confidence judgements children provided C). Thus for all three statement types, children expressed higher con-
regarding their decisions whether to endorse statements as “old.” If fidencewhentheyacceptedastatementascomingfromthestory.This
children were confused by the hybrid statements, we expected they analysis provides additional evidence that children were not simply
would have lower confidence judgements regarding those statements confused bythehybridstatements—metacognitively, theytreatedhy-
compared to old and new statements. To address this possibility, we bridstatementsnodifferentlythanoldandnewstatements.
conductedaone-wayrepeatedmeasuresanalysisofvariance(ANOVA)
with statement type(old, new, hybrid) asawithin-subjects factor. As 2.7. Discussion
suggestedbyinspectionofFig.5,PanelB,theANOVArevealedamain
effect of statement type, F(2, 98)=48.30, p < .001, η2=0.33. The findings on self-derivation of new factual knowledge through
Follow-up comparisons with Bonferroni corrections revealed that memory integration in the present experiment replicate those from
9
P.J.Bauer,etal. Learning and Instruction 66 (2020) 101271
Fig.5.Endorsementofstatementsas“Old”asafunctionofstatementtype(PanelA)andratingsofconfidenceinendorsementofstatementsas“Old”asafunctionof
statementtype(PanelB)inExperiment2.
Experiment 1. The children self-derived new factual knowledge in distracters were familiar terms (e.g., Question: “What animal is the
open-ended testing and selected the correct answers from among mostpopularchocolatebarintheworldnamedafter?”Answerchoices:
forced-choiceoptions.Open-endedself-derivationperformancedidnot “ahorse,apig,asheep.“).Incontrast,inExperiment2,thedistracters
differ from that in Experiment 1, even though in the present experi- werelessfamiliarscientificterms(e.g.,Question:“Whatisthenameof
ment,thecontentoverwhichthechildrenoperatedwasderivedfrom Saturn'slargestmoon?”Answerchoices:“Predator,Titan,Epperson.“)
theirsciencecurriculum.Thesefindingsbearonthesuitabilityofself- Nevertheless,inthisexperiment,asinExperiment1,forced-choicese-
derivation through memory integration as a model of classroom lectionofintegrationandstemfactswasreliablygreaterthanchance.
learning,demonstratingthattheprocessextendstoacademiccontent. TheresultsfromSession2makeclearthatthechildrenremembered
Children's open-ended stem-fact recall also did not differ between ex- detailsofthestoryepisodesthatwerethebasisforself-derivationofthe
periments.However,inforced-choicetesting,childreninExperiment1 integration facts. They correctly indicated that story statements that
selected correct answers to integration and stem-fact questions more hadbeenpresentedwere“old,”andthatstorystatementsthathadnot
frequently than children in Experiment 2, though the difference for beenpresented inanyform were“new.”Rates ofendorsement ofthe
integrationfactswasnotstatisticallysignificant.Wespeculatethatthis hybrid statements were intermediate between those for old and new
may be due to the nature of the distracters. In Experiment 1, the statements; they nevertheless were significantly below chance. Thus
10