Table Of ContentCONTROL OF GENE EXPRESSION BY CATECHOLAMINES AND THE RENIN-ANGIOTENSIN
SYSTEM
Control of Gene Expression by Cat-
echolamines and the Renin-Angiotensin
System
Edited by
HEINZ RUPP BERNARD MAISCH
Internal Medicine and Cardiology Internal Medical
Molecular Cardiology Laboratory Molecular Cardiology Laboratory
Philipps University of Marburg Philipps University of Marburg
Karl-von-Frisch-Strasse 1 Karl-von-Frisch-Strasse
35044 Marburg, Germany 35033 Marburg, Germany
Reprinted from Molecular and Cel/ular Biochemistry, Volume 212 (2000)
Springer Science+Business Media, LLC
Library of Congress Cataloging-in-Publication Data
Control of gene expression by catecholamines and the renin-angiotensin system /
edited by Heinz Rupp, Bemhard Maisch
p. cm. -- (Developments in molecular and cellular
biochemistry ; v. 33)
ISBN 978-1-4613-6955-4 ISBN 978-1-4615-4351-0 (eBook)
DOI 10.1007/978-1-4615-4351-0
1. Genetic regulation. 2. Angiotensin II. 3. Catecholamines.
1. Rupp, Heinz. II. Maisch, Bemard. III. Series
QH450 .C66 2000
572.8'65--dc21 00-135010
Printed an acid-free paper
All rights reserved
© 2000 Springer Science+Business Media New York
OriginallY published by Kluwer Academic Publishers in 2000
No part of the material protected by this copyright notice may be reproduced or
utilized in any form or by any means, electronic ar mechanical,
including photocopying, recording or by any information storage and
retrieval system, without written permission from the copyright owner
Molecular and Cellular Biochemistry:
An International Journal for Chemical Biology in Health and Disease
CONTENTS VOLUME 212, Nos. 1 & 2, September 2000
Control of gene expression by catecholamines and the renin-angiotensin system
Drs. Heinz Rupp and Bernard Maisch
Preface
P. Haus-Seuffert and M. Meisterernst: Mechanisms of transcriptional activation of cAMP-responsive element-binding protein
CREB 5-9
F.U. Muller, I Neumann and W. Schmitz: Transcriptional regulation by cAMP in the heart 11-17
D. Jean and M. Bar-Eli: Regulation of tumor growth and metastasis of human melanoma by the CREB transcription factor family 19--28
YS. Cho-Chung, YG. Park, M. Nesterova, YN. Lee and YS. Cho: CRE-decoy oligonucleotide-inhibition of gene expression and
tumor growth 29--34
A. von Knethen and B. Brune: Attenuation of macrophage apoptosis by the cAMP-signaling system 35-43
U. Riese, S. Brenner, W.-D. Docke, S. Prosch, P. Reinke, M. Oppert, H.-D. Yolk and C. Platzer: Catecholamines induce IL-I0
release in patients suffering from acute myocardial infarction by transactivating its promoter in monocytic but not in T-cells 45-50
I Lim, C. Yang, SJ. Hong and K.-S. Kim: Regulation oftyrosine hydroxylase gene transcription by the cAMP-signaling pathway:
Involvement of multiple transcription factors 51-60
M. Sieber-Blum and Z. Ren: Norepinephrine transporter expression and function in noradrenergic cell differentiation 61-70
IS.D. Chan, T.-T. Wang, S.-L. Zhang, X. Chen and S. Carriere: Catecholamines and angiotensinogen gene expression in kidney
proximal tubular cells 73-79
C.S. Narayanan, Y Cui, S. Kumar and A. Kumar: cAMP increases the expression of human angiotensinogen gene through a
combination of cyclic AMP responsive element binding protein and a liver specific transcription factor 81-90
P.P. Sayeski, M.S. Ali and K.E. Bernstein: The role ofCa2+ mobilization and heterotrimeric G protein activation in mediating tyrosine
phosphorylation signaling patterns in vascular smooth muscle cells 91-98
S. Meloche, S. Pelletier and M.J. Servant: Functional cross-talk between the cyclic AMP and Jak/STAT signaling pathways in
vascular smooth muscle cells 99--109
X. Wang and T.I Murphy: The inducible cAMP early repressor ICERIIy inhibits CREB andAP-I transcription but not AT I receptor
gene expression in vascular smooth muscle cells 111-119
SJ. Vyas, C.M. Baschak, M.R. Chinoy and E.K. Jackson: Angiotensin II-induced changes in G-protein expression and resistance
of renal microvessels in young genetically hypertensive rats 121-129
A. Dagnino-Subiabre, K. Marcelain, C. Arriagada, I. Paris, P. Caviedes, R. Caviedes and I Segura-Aguilar: Angiotensin receptor
II is present in dopaminergic cell line of rat substantia nigra and it is down regulated by aminochrome 131-134
H. Rupp, M. Benkel and B. Maisch: Control of cardiomyocyte gene expression as drug target 135-142
D. Mohuczy and M.1. Phillips: Designing antisense to inhibit the renin-angiotensin system 143-153
A.R. Brasier, M. Jamaluddin, Y Han, C. Patterson and M.S. Runge: Angiotensin II induces gene transcription through cell-type
dependent effects on the nuclear factor-KB (NF-KB) transcription factor 155-169
E. Mascareno and M.A.Q. Siddiqui: The role of Jak/STAT signaling in heart tissue renin-angiotensin system 171-175
R. Aikawa, I. Komuro, R. Nagai and Y Yazaki: Rho plays an important role in angiotensin II-induced hypertrophic responses in
cardiac myocytes 177-182
L.M. Khachigian, Y Takuwa and T. Collins: Mechanisms of angiotensin II-induced platelet-derived growth factor gene expression 183-186
H. Matsubara, Y. Moriguchi, Y Mori, H. Masaki, Y Tsutsumi, Y Shibasaki, Y Uchiyama-Tanaka, S. Fujiyama, Y Koyama, A.
Nose-Fujiyama, S. Iba, E. Tateishi and T. Iwasaka: Transactivation ofEGF receptor induced by angiotensin II regulates fibronectin
and TGF-p gene expression via transcriptional and post-transcriptional mechanisms 187-201
K. Tamura, YE. Chen, Q. Chen, N. Nyui, M. Horiuchi, I. Takasaki, N. Tamura, R.E. Pratt, VJ. Dzau and S. Umemura: Expression
of renin-angiotensin system and extracellular matrix genes in cardiovascular cells and its regulation through AT! receptor 203-209
D.H. Wang and I Li: Regulation of angiotensin II receptors in the medullary thick ascending limb 211-218
M. Turcani and H. Rupp: Bradykinin (B) independent effect of captopril on the development ofp ressure overload cardiac hypertrophy 219-225
S. Takeo, Y Nasa, K. Tanonaka, F. Yamaguchi, K.-1. Yabe, H. Hayashi and N.S. Dhalla: Role of cardiac renin-angiotensin system
in sarcoplasmic reticulum function and gene expression in the ischemic-reperfused heart 227-235
Index to Volume 212 237-239
Molecular and Cellular Biochemistry 212: 1,2000.
© 2000 Kluwer Academic Publishers.
Preface
This special issue of Molecular and Cellular Biochemistry and angiotensin II influences also become increased. Due
focuses on 'Control of Gene Expression by Catecholamines to beta-adrenergic receptor downregulation, depressed cat
and the Renin-Angiotensin System' in health and disease. In echolamine influences are expected in the final stage of heart
recent years, great progress has been made in the under failure. An imbalanced influence of catecholamines and an
standing of catecholamine and angiotensin II modulated giotensin II on gene expression leads to disordered molecular
gene expression. There is also increasing evidence that cat structures of the cell and an impaired cell function.
echolamine and angiotensin II induced cellular injury not The focused issue is organized into chapters focusing on
solely arises from classical pathways but also from a per catecholamines, angiotensin II and the interaction between cat
turbed gene expression. echolamines and angiotensin II. Basic biochemical processes
Taking into account that catecholamines and angiotensin II are covered in detail and the potential of these pathways
are vital for a balanced gene expression of many cells, the for explaining chronic diseases associated with excess cat
intriguing possibility arises that various diseases are initiated echolamine and angiotensin II influences should become
or aggravated by such an imbalance. Catecholamine and an apparent. It is hoped that the focused issue triggers novel
giotensin II influences can be in excess arising from, for research into the development of drugs that are targeted at
example, hypercaloric food intake or psychosocial stress. diseases characterized by an imbalanced gene expression
During early progression of heart failure, sympathetic activity involving catecholamines and angiotensin II.
HEINZ RUPP, Professor of Physiology
BERNHARD MAISCH, Professor of Medicine
Molecular Cardiology Laboratory
Department of Internal Medicine and Cardiology,
Philipps University of Marburg
Marburg, Germany
PART I
CATECHOLAMINE INFLUENCES ON GENE EXPRESSION
Molecular and Cellular Biochemistry 212: 5--9, 2000.
© 2000 Kluwer Academic Publishers.
Mechanisms of transcriptional activation of cAMP
responsive element-binding protein CREB
Philipp Haus-Seuffert and Michael Meisteremst
Institute ofM olecular Immunology, Department for Proteinbiochemistry, GSF, Munchen, Germany
Abstract
The CREB-CREM transcription factors are the main gene regulatory effectors of the cAMP signaling pathway. The investiga
tions of this family of transcription factors had a profound impact on the understanding of signaling-induced gene transcrip
tion. Here we discuss some key aspects of the underlying biology, review transcriptional activation by CREB proteins through
transcription cofactors and present novel insights into the context-and position-specific function ofCREB on complex genes.
(Mol Cell Biochem 212: 5-9, 2000)
Key words: transcriptional regulation, gene expression, coactivator, repressor
Biology
CRE although it does not appear to be responsible for its tes
tis-specific expression [4]. CREB seems to also function as
The cAMP-pathway is a widely used signaling process that an effector of angiotensin II signaling. The stimulatory ef
senses and amplifies the response of cells to hormones, fect of angiotensin II depends on a cAMP-responsive element
growth factors and neurotransmitters. Among the target pro within the fibronectin promoter [5]. Angiotensin II stimu
teins of protein kinase A are the transcription factors CREB lation leads to moderate induction of the CREB protein in
and CREM. Gene regulatory programs induced by CREB human mesangial cells. Angiotensin II increases interleukin-
control different biological processes (for review see [1]) 6 expression in a dose-dependent manner, which is mediated
such as T cell development, spermatogenesis, long term through a cAMP-responsive element in the interleukin-6 pro
memory but also the regulation of the blood pressure through moter [6]. As one other example a cAMP-responsive element
angiotensin. The latter is the focus of this issue. is found in the tyrosine hydroxylase gene promoter [7]. In
this study the CRE proves to be one critical angiotensin 11-
responsive element in cultured bone adrenal medullary cells.
Angiotensins
Regulation of long term memory
There is increasing evidence, that the protein CREB is in
volved in the biology of the renin-angiotensin system (RAS),
which plays an important role in the regulation of the blood A correlation between memory and cAMP pathways became
pressure. Expression of the rat angiotensinogen gene is posi first evident in genetic studies. Flies were trained to discrimi
tively influenced by CREB in a cAMP-dependent manner nate between two different odors, one accompanied with an
[2]. The stimulating effect ofCREB depends on a functional electric shock, and the other not associated with a shock.
cAMP-responsive element (CRE), located in the 5' -flanking Chemically mutagenized flies were used to find mutants
region of the angiotensinogen gene [3]. The expression of which failed to learn the discrimination between the two
testis angiotensin converting enzyme depends on a functional odors without being affected in other characteristics like 10-
Address for offPrints: M. Meisterernst, Institute of Molecular Immunology, Department for Proteinbiochemistry, GSF, Marchioninistrasse 25, D-8l3 77 Munchen,
Germany
6
comotion or odor detection [8]. Four mutants were found and Activation DNA binding
the corresponding genes were identified. Remarkably, three 271aa ATF-l
out of four mutants affect molecules that are involved in
cAMP signaling [9]. Long term - in contrast to short term
341aa CREB/CREM
memory storage depends on transcriptional activity and the
/
synthesis of new proteins [10]. Studies in Drosophila and
Aplysia demonstrated that CREB is critically involved in this
PKA
process [11]. One model implies that CREB-mediated tran CKII Ser133 CKII
scription activates a gene expression program that ultimately
1 1 1 1 1 1 11 1
leads to the production of new synapses between neurons and AESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSA CREB
a prolonged stabilization of the synaptic facilitation (see re AEfDDfADfE--VIDfHKRREILfRRPfYRKILNELffDVPGIPKIEEEKfEEEGTP CREM
view [12]).
CKII CKI GSK-3 Ser117 CKI
PKA CKII
PKC cdc2
CREB function in the immune system CamK
cdc2
S6
ATF/CREB proteins are involved in the development and Fig. 1. Structure of A TF -I, CREB and CREM proteins. The P-box, the
function ofT lymphocytes. The signal transduction pathways glutamine-rich domains (QI and Q2) and the DNA binding region (leucine
in T cells after T-cell receptor engagement, which lead to zipper and basic domain) are indicated. Sequence alignment of the P-boxes
ofCREB and CREM. Serine and threonine residues can be phosphorylated
phosphorylation and activation of CREB, include protein
by the indicated kinases as marked by arrows.
kinases C, RAS, RAF-1, MEK and RSK2 [13]. Functional
binding sites for members of the ATF/CREB family were
identified in the promoters and enhancers of many T-cell quence, flanking bases are important for binding of CREB
specific genes, including the TCR-a and -p enhancers [14, [24].
15], the CD38 enhancer [16] and the TCR Vp promoters [17]. The members of the CREB family of transcription factors
Transgenic models provided strong in vivo evidence for the share structural features within their transactivation domains.
importance of CREBIA TF proteins in the immune system. Transcriptional activation is mediated through two regions
CREB knock-out mice show defects in the development of (compare Fig. 1). One region contains several recognition
specific T-cell lineages [18]. A dominant negative form of motifs for protein kinases. It is therefore called kinase in
CREB under the control of the T-cell specific CD2 promoterl ducible domain (KID) or phosphorylation box (P-box). The
enhancer leads to a profound defect in T cell proliferation transactivation potential of CREB proteins critically depends
after stimulation of the T-cell receptor pathways [19]. on their phosphorylation status [25, 26]. The other constitu
tive activation region, contained in CREB and CREM, con
sists of two glutamine-rich motifs, called Q1 and Q2, which
CREB structure
flank the kinase inducible domain [27]. Mammalian ATF-1
lacks Q1 but contains Q2 [28]. Glutamine-rich regions can
The CREBIA TF family consists of a large number of genes be found in many regulatory, coactivator and basal transcrip
that include the factors CREB, CREM, ATF -1, ATF -2, ATF- tion factors and serve as interaction surfaces for other tran
3 andATF-4 (also known as CREB2). Various splice variants scription factors. It has been suggested that CREB and CREM
of each of these proteins have been identified which activate require the P-box and at least one glutamine-rich domain [27,
or repress transcription (see review [20]). CREB, first iden 29] to activate transcription.
tified [21], is probably one of the most meticulously charac Several isoforms of each member of the CREB family of
terized transcription factors in eukaryotes. transcription factors were identified. Glutamine-rich regions
A common feature of all the family members is a basic re can be removed via alternative splicing, either partially (in
gion leucine zipper (bZIP) domain (Fig. 1). The leucine zip Drosophila CREB2b) or completely (in mammalian CREMa,
per consists of an a-helical coiled-coil structure, which forms CREMP and CREMy), with the consequence that these pro
homo- and heterodimers. A particular 'dimerization code' teins display repressor function [29]. The insertion of pre
determines which heterodimers are possible [22]. The basic mature stop co dons in the CREB gene results in truncated
region is responsible for the sequence-specific DNA-bind proteins that lack the DNA-binding region and that also func
ing ofthe CREB transcription factors to cyclic AMP-response tion as repressors. In Aplysia, a CREB isoform was identi
element (CRE). The cognate DNA-recognition motiffor the fied, which lacks the nuclear localisation signal [30]. This
CREB homodimer is a symmetric palindromic motif with se cytoplasmic form (CREB 1c ) regulates the activity ofkinases
quence 5'-TGACGTCA-3' [23]. In addition to the core se- that phosphorylate nuclear CREB.
7
Signal-induced activation by CREB be a tissue-specific coactivator for CREM. It possesses an
intrinsic activation domain and interacts with CREM in a
phosphorylation-independent manner. In addition to the in
CREB binding sites had been identified in a multitude of
ducible P-box domain, CREB also contains a constitutive
inducible promoters. Examples are the somatostatin-[31] and
activation domain (CAD), which is responsible for the inter
the proenkephaline promoter [32] as well as many others (see
action with one or more of the TATA-box associated factors
reviews [1,20]) The critical region in CREB for the response
(TAFs), one of which is TAF,,110 (the drosophila homolog
to cAMP [25] is the phosphorylation box (P-box) or kinase
of human TAF,,130). The constitutive activation domain of
inducible domain (KID). As depicted in Fig. 1, the P-box
CREB can be subdivided into three regions, which are rich
contains several consensus phosphorylation sites for kinases
in either serine, hydrophobic amino acids, or glutamine. All
such as PKA, PKC, glycogen synthase kinase-3 and casein
three regions are necessary for effective interaction with
kinases (CK) I and II [25] [33]. Upon activation of the ade
TAF,,110 in a yeast two-hybrid assay [43].
nylate cyclase pathway, the serine at position 133 of CREB
(serine 117 in CREM) is phosphorylated by PKA, which
enhances the transcriptional activity of the proteins CREB
andCREM. Transcriptional effects of CREB are
In addition to PKA, other signal transduction pathways tar context- and position-specific
get the CREB protein, in order to either increase or decrease
its transcriptional activity. For example, the Ca2+- calmodulin
The biological effects of the cAMP pathway through CREB
dependent kinase IV (CaMKIV) phosphorylates CREB at
are entirely based upon a gene expression program initiated
Serl33 after membrane depolarization in neuronal cells [34].
by the activator. Hence, unraveling of CREB transcriptional
Also signal transduction pathways triggered by growth fac
activation is crucial for the understanding of the biological
tors and inflammatory cytokines lead to a phosphorylation
processes. Above we have discussed CREB-structure and -
ofCREB (see review [35]). Ca2+-calmodulin-dependentkinase
function through cofactors. Additional important parameters
II (CaMKII) phosphorylates CREB at Ser133 and Serl42.
for CREB function are the context in which CREs are em
Remarkably, phosphorylation ofSerl42 by CaMKII neutral
bedded and the position of CREs relative to the start site of
izes the activity of CREB [36].
transcription. This has been most clearly demonstrated on the
gene encoding the T-cell receptor beta (TCR~) chain [44].
These studies could have model character for the many other
CREB and CREM activate through
target genes of cAMP-induced CREB proteins and, therefore,
transcription co factors
will be briefly reviewed here.
The TCR~ gene is an attractive model for the study of pro
A breakthrough in the understanding of inducible CREB fun moter and enhancer function. This is mainly based upon the
ction came from the discovery of the cofactor CBP (CREB fact that the genome contains many different promoters that
binding protein) that interacts specifically with the phospho can be compared. A functional TCR!) gene is generated through
rylated CREB P-box domain [37]. In the current model, the recombination events in which the enhancer is brought into
cofactor CBP and its close relative p300 serve as bridging the relative vicinity of one of the many V!) promoters (al
factors between the activator CREB and the general transcrip though it remains a distal element, several kilobases apart
tion factors [27, 38]. These cofactors also possess a histone from the promoter). The rearranged TCR~ gene contains
acetyltransferase (HAT) activity, which is thought to playa CREs in three different positions that seem to fullfill alter
critical role for gene activation in the chromatin (reviewed native tasks (Fig. 2). Firstly, CREs are contained within the
in [39]). CBP and p300 bind to other cofactor complexes distal TCR~ enhancer [15]. Secondly, in many V~ promot
among them PCAF, SRC-l!NcoA-l, TIF-2!NcoA-2 and pCIP/ ers one CRE is found in a promoter-proximal position [17],
ACTR which also possess histone acetyltransferase activity in between position -1 00 to -40 upstream of the start site of
(reviewed in [40]). There are indications for the formation transcription. In our studies of the human V~ 8.1 promoter
of gene-and pathway-specific complexes. For example, bind we could also detect a third cryptic CRE within the core pro
ing of CBP to PCAF and pCIP has been reported to be neces moter region [44], located in between position -30 and +1 1
sary for induced CREB function [41]. The interaction between (compare Fig. 2). This is the region where TFIID and the
cofactors and the P-box of CREB and CREM is not always other general transcription factors bind to the promoter.
phosphorylation-dependent. A new route for transcriptional In the enhancer CREB appears to be part of a multiprotein
activation by CREB and CREM was reported recently, dem enhanceosome [15]. The enhancer is efficiently repressed by
onstrating the functional interaction between ACT (for acti overexpression of the 12S form of adenovirus encoded E 1A ,
vator of CREM in testis) and CREM [42]. ACT appears to which is known to compete for the CREB-binding proteins
8
CBP and p300. One simple scenario would imply that CBP plexity to the control of cAMP-induced gene activation in
binds to and functions via binding to CREB in the enhancer. other biological processes.
However, ElA retained its repression potential even after
removal of the CRE. Repression by ElA seems to be rather
correlated to the overall enhancer activity. This suggests that Acknowledgements
CBP is part of, or functions through, the multiprotein en
hanceosome rather than through individual activators alone
We must apologize to the many researchers whose contribu
such as CREB [45]. Further evidence for this hypothesis came
tions could not be cited mainly for space limitations. We thank
from experiments with multimerized CREs that proved to act
Peter Halle (Switch Biotech Inc., Munich) for providing un
as a poor enhancer element at a distance (unpublished obser
published observations and Barbara Giinzler and Gerhard
vations). The promoter-upstream (VAS) CRE mainly serves
Mittler (Gene Center, Munich) for their support during prepa
as a platform for the enhancer. This is concluded from the fact
ration of the manuscript.
that it raises relative enhancer activity but displays little in
fluence on the promoter [44, 45]. Activation requires an in
tact PKA phosphorylation site in CREB. In contrast, the third References
functional CRE within the core promoter contributes strongly
to V~ 8.1 promoter activity. This low affinity CRE can be ac I. Sassone CP: Transcription factors responsive to cAMP. Annu Rev Cell
tivated through overexpression of CREB, but not through a DevBiolll: 355-377, 1995
mutant lacking Ser133. Moreover, replacement of the weak 2. Qian JF, Wang TT, Wu XH, Wu J, Ge C, Lachance S, Carriere S, Chan
CRE by a consensus CRE efficiently raises promoter activ JS: Angiotensinogen gene expression is stimulated by the cAMP-re
sponsive element-binding protein in opossum kidney cells. J Am Soc
ity [44]. Thus, the core CRE is critical for promoter function,
Nephrol8: 1072-1079,1997
whereas the two other CREs help to establish a functional
3. Wang TT, Chen X, Wu XH, Zhang SL, Chan JS: Molecular mechanism( s)
enhancer. Related mechanisms could add a new level of com- of action of isoproterenol on the expression of the angiotensinogen gene
in opossum kidney proximal tubular cells. Kidney Int 55: 1713-1723,
1999
4. Esther CJ, Semeniuk D, Marino EM, Zhou Y, Overbeek PA, Bernstein
Enhanccr KE: Expression of testis angiotensin-converting enzyme is mediated
by a cyclic AMP responsive element. Lab Invest 77: 483-488, 1997
5. Nahman NJ, Rothe KL, Falkenhain ME, Frazer KM, Dacio LE, Madia
1« JD, Leonhart KL, Kronenberger JC, Stauch DA: Angiotensin II induc
tion of fibronectin biosynthesis in cultured human mesangial cells:
Association with CREB transcription factor activation. J Lab Clin Med
*
127: 599--611,1996
6. Funakoshi Y, Ichiki T, Ito K, Takeshita A: Induction of interleukin-6
CBP/p300 expression by angiotensin II in rat vascular smooth muscle cells. Hy
pertension 34: 118-125, 1999
7. Kim EL, Esparza FM, Stachowiak MK: The roles of CRE, TRE, and
TRE-adjacent S I nuclease sensitive element in the regulation of tyro
sine hydroxylase gene promoter activity by angiotensin II. J N eurochem
CHROMATIN
67: 26--36, 1996
8. Dudai Y, Jan YN, Byers D, Quinn WG, Benzer S: Dunce, a mutant of
-69 VAS -42 +1 Drosophila deficient in learning. Proc Natl Acad Sci USA 73: 1684-
CORE
1688,1976
Promotcl'
9. Dubnau J, Tully T: Gene discovery in Drosophila: New insights for
learning and memory. Annu Rev Neurosci 21: 407-444, 1998
Fig. 2. Position depending function ofCREs. The model is based upon the 10. Davis HP, Squire LR: Protein synthesis and memory: A review. Psychol
analysis of the TCRP gene consisting of the distal enhancer and the Vp 8.1 Bull 96: 518-559, 1984
promoter. CREs (cAMP-responsive elements) are found within the TCRP II. Dash PK, Hochner B, Kandel ER: Injection of the cAMP-responsive
enhancer and the VP8.l promoter. The promoter comprises two CREs up element into the nucleus ofA plysia sensory neurons blocks long-term
stream of the core region (upstream activating sequence (UAS)) and within facilitation. Nature 345: 718-721, 1990
the core region (positions -30 to + II). Only the core element affects pro 12. Mayford M, Kandel ER: Genetic approaches to memory storage.
moter activity (arrow) whereas the two other elements mainly contribute Trends Genet 15: 463-470, 1999
to enhancer-promoter communication. Possible functional interactions be 13. Muthusamy N, Leiden JM: A protein kinase Co, Ras-, and RSK2-de
tween the enhancer and the promoter via the cofactor CBP/p300 are indi pendent signal transduction pathway activates the cAMP-responsive
cated by black arrows. The model implies that upon interaction with the element-binding protein transcription factor following T cell receptor
enhanceosome CBP and p300 acetylate histones (grey arrow), which could engagement. J BioI Chern 273: 22841-22847, 1998
help to keep the promoter accessible for CREB and other activators that bind 14. Mayall TP, Sheridan PL, Montminy MR, Jones KA: Distinct roles for
to weak interaction sites on the core promoter and subsequently activate P-CREB and LEF-I in TCR alpha enhancer assembly and activation
transcription. on chromatin templates in vitro. Genes Dev II: 887-899, 1997