Table Of ContentAPOLL1O1
FLIGHPTL AN
-506/CS/ML-M1-057
;
"''.\ �·�� ' ·.
'V
(.� <.
APRi1l5 1,9 69
\
)
'<D4
PREPARBEYD
FLIGPHLTA NNINBGR ANCH
FLIGCHRTE WS UPPORDTI VISION
MANNED SPACECRAFCTE NTER
HOUSTON,TEXAS
) - -
./
APOLLOl l
APOLLAOS -506/CSM-107/LM-5
PRELIMINAFRLYI GHTP LAN
APRIL1 5,1 969
-/ f)/ .;
I (-<""
Submittebdy :j - ,j" A-c.
.
J./fHche
L.
FlightP lanninBgr anch
G. M. Colton
FlightP lanninBgr anch
T. A. Guillory '1
FlightP lanninBgr anch
::-v--:>-�d"l??}?
I
Approvebdy : :h
W.J . Nor
n
Chief, t CrewS upporDti vision
Anyc ommentosr questionosn thisd ocumensth ouldb e
forwardteodT . A. GuilloryF,l ightP lanninBgr anch,
mailc odeC F34,e xtensio4n2 71.
TABLE COOFN TENTS
Abbreviations
Introduction i i
SECTIOIN -GENERAL
MissioDne scription
1. 1-1
SummaryF lighPtl an( TLC-TEC)
2. 1-5
( )
SummaryF lighPtl an LunarO rbit
3. 1-6
RendezvoPurso file
4. 1-7
CSMB urnS chedule
5. 1-8
LMB urnS chedule
6. 1-9
7. LunarL andinSgi teD ata 1-10
CSMF lighPtl anN otes
8. 1-11
LM FlighPtl anN otes
9. 1-20
CommunicatioPnlsa n
10. 1-29
SECITON II- UPDATEF ORMS
ManeuveUrp datFeo rms
1. 2-1
CSMM aneuveUrp date Pads
2. 2-2
LMM aneuveUrp datPea ds
3. 2-22
SECTIONI II- DETAILTEIDEM LINE
LauncPhh ase
1. 3-i
TLIT-&D
2. 3-3
TranslunCaora stA ctivities
3. 3-5
a. CislunaNra vigation
3-7'3 -19
b. LM Familiarization
3-37
c. LunarO rbitI nsertion
3-48
LunarO rbitA ctivities
4. 3-48
a. SeconLdM Ingress 3-53
b. LM Activatiaonnd C /0
3-62
i
- -�-�---
SECTION III CONT'D
c. Undocking 3-66
d. Touchdown 3-68
e. EVA 3-78
f. LM Liftoff 3-88
g. LM ActivDeo cking 3-92
5. TEl-TEC 3-97
6. Entry 3-134
SECTIOINV DETAILETDE STO BJECTIVES
l. DetaileTde stO bjectives 4-l
2. TestO bjective/MisAscitoinv itCyr ossR eference4 -3
3. TestO bjectives 4-6
SECTIOVN -CONSUMABLES
RCSP ropellaUnsta ge 2-l
l.
2. SM RCSB udget 5-4
3. SPSB udget 5-24
4. LM RCSB udget 5-26
5. DPSB udget 5-30
6. APSB udget 5-31
7. CSME PSB udget 5-33
8. LM EPSB udget 5-38
9. LM ECSB udget 5-42
l PLSSB udget 5-47
0.
SECTIOVNI - SUMMARFYL IGHPTL AN
SummarFyl ighPtl an 6-l
i i
INTRDOUCTION
ThisF lighPtl anh asb een prepabrye tdh eF lighPtl anninBgr anchF,l ight
CrewS upporDti visiowni,t ht echnicsaulp porbty TRWS ystems.
Thisd ocumenstc hedultehse A S-506/CMS-107/LM-o5p eratioannsd c rewa ctivities
to fulfillw,h enp ossiblteh,e t esto bjectives deifni tnheedM issioRne
quirementGs T,y peM issioLnu narL andingt o be published.
Thet rajectoprayr ameteursse di n thisF lighPtl ana ref orJ uly1 6,1 969
launchw,i tha launch azimauntdwh e res uppliebdy MissioPnl anninagn d
72°
AnalysiDsi visioans definebdy theA pollo MisGs iSopna cecraOfpte rational
Trajectotroy b e published,
TheA poll1o1 FlighPtl ani s undert hec onfiguration coofn tthreoC lr ew
ProcedurCeosn troBlo ard( CPCB).A ll proposed cthoa tnhgiessd ocument
thatf alli n thef ollowicnagt egorisehso ulbde submitttedo theC PCBv ia
a CrewP rocerdeusC hangRee quest:
l. Itemst hati mposaed ditioncarle wt raininogr impacctr ewp rocedures.
Itemst hati mpactth ea ccomplishmoefn dte tailetde sto bjectives.
2.
3. Itemsth atr esulitn a significant orR ECPSS b udgecth ange.
4. Itemst hatr esulitn movinmga jora ctivititeos a differeanctt ivity
dayi n theF lighPtl an.
5. Itetmhsa tr equirae c hangteo thef lighdta taf ile,
TheC hief,F lighPtl anninBgr anch( FCS)D willd etermiwnhea tp roposecdh anges
falli n thea bovec ategories,
Mr.T . A. Guillorwyi lla cta s co-ordinaftoorra llp roposecdh angetso
theA poll1o1 FlighPtl an.
Anyr equestfso ra dditioncaolp ieosr changetso thed istributiloins tso f
thisd ocument mbues mta dei n writintgo Mr.W . J. NorthC,h iefF,l ight Crew
SupporDti visioMnS,C ,H oustonT,e xas.
iii
--- ----
ABBREVIATIONS
ACCEL Acclee ro"·eter EQUIP Equipment L/V Local Vertical '" F!O!!tine
AAACCCHTQ AAAcstQuctiseilin�t�i.s�onn t ion EEEVVSATA P EE[xvata'>trp aeoe�rnhrSi acttu�loanrrd AacrTtdiiv meit y 'L �PD LMaanudnatcoVrhey h iclPer eo;surOeis phy S5/AC SSphaacfOAnt'Xgc lXre d ft
AEA AbortEl ectrnoics Assembly EVT E�travehicuTlraarn sfer MAO Madrid• Spain SigMlC onditioningf qui�·ment
AbortG uid�ncSeu bsystem EXT EKtemal "" Manual "' Stabilization ControSly sten'
AGS AmpereH ours Ha�imum m>C T ScanninTge lescope
AH Altitude f Stop "'MAX' Q Jll.uill'lllll DynamiPcre ssure SEC Secondary
AMAPU or amp Ampere FC FFu elC ell MCC HidcoursCeo rreciton SECO S·IVBE nginCeu t·off
AMPL A� ifier FDA! Fl1ghDti rector Attitude Indicator MCC·H MhsfonC ontroCle nte·r Huustun SEP Separate
ANG Antilgua FLT Flight or MCC SEQ Sequence
Ant Antenna Freq�tency Modulated MDC MainO isplay Con�ole )!VI! SaturTnV B(Thr1d S tage)
AOH Apollo Operations Handbook FM Fieldo f View Measurement SLA ServicMoed uleL M Addpter
AOS AcquisitioofnS igndl or Acquisitioofn S ite rfposvo r FPSF eetp er second !<MEASR USNSf'le rcury SLOS StarL ne·of·Sight
AAPOST AAlsc1egnnmePtnr toO pputlisciaSTloue nlb essycsotpeem FFTT Po rf t fFueleltT hrottlPoes ition MET MMiiddslsei oEiGnm�b ealn tTAn igmlee r SSMP OT SSpeontriMc ieetM oedrul e
ARS Atmosphere MGA '" ServicPer opulsiSoyns tem
AAUTXT AAutKtiItHuader y Revit.!.lllation GBGIB M GGrraannddB ahBaamhIa(a sH1lS114aF Nn)d sE,a sterTne stR ange "-MHi'I! N HeM11ri\rnn\itl m Imulsmuolm a nnpd ,u Fhleo rida SSRR C SSaumnprlhReeet urnC ontainer
Al Azimulh GOC GyroD isplay Coupler "'" Mlneuver SRX S�BanRde ceiveMro deN o.X
GDS Goldstone, California MPS Hain PropulsiSoyns tem Sunset
BBOAAT BBearnt1.1tdear y GGEETTI GGrroouunnEEddlh a ppsseedd TT iimem eo f Ignition "'M"T VC MilMnanneudaST lhp rauus FVtle icgthoNtCre o tnwtorrokl sSTsX SSo-lSara nWTdir nadCn osmtmop 1�n oendte N o.X
Bio Bio·HedilDaalt ao n VoiceDo wnilnk GLY Glycol swc Switch
BP Barber Pole CIIT Gree11ri11chH eanT lme H1 Nitrogen s. SeKtant
BT BurnT i···e G&N Guidancaned Navigaton NAV Navigation SXT
BU Backup CJfCS GuidancNea vigatiCioonnt rol System NCC CorrectiCvoem binatiMoann euver Timeo f EphemerisU pdate
BBR&KWT BBrlaacckkeWht i t&e GGYWMM GGuuaamy m,a s ic o NM IIM NNomauintailc aMli les TTEA P HEM TrunnioAnn gle
CAPC OM CCaaplsiublrCeaOOil tliuAonnnig claet or HHA2 HAypdorgogeeAen Het illt ude NNSXRX NNo01u11lnnX aXl S low Rate T" A(N >) TTfamnneaaB rais�eeN, o Jota.d a.gascar
< CCCCACAMCBCCCCCCCCCCCCCCCCMCCMCCOKDNROO/&SPYRSOPDCDIMML OT NHOA t«JDWYIMN F DURRL N I SO S T CGT J CCCCGCCCCCCCCCCCCCCCCCCCCooooOO'm�ooroaoaooihrrooooiaiTJirunnnendnaiTJiuereynvnfl'IeiTJilrJITI4nrmtctflntttrukiinlplccoaanscewMiianronOog nnd�luulkgnlndtur onCluirodupncree enih eid d .siaaud vt.JPataBSMM rdnr np nt Otn on,tDoi reooi ig iitt aai denP'ocenSdrodlo zci rWtnt nudaaeu�tuAasaA caIy .,sluklqUlstrl tl nn PlCA leeurceiialMifiorea eennt1 lgoot mp n digonn1d� uctt t SmI u ydeu eenlse Snrie titt meg i hatt iMoann euver HJHIHHHHHHIkIIHIIIIIIBESITTAwpMDNVNGPUVCOGNRT KhRYW UITTA CO T T U IHHJHUIHHHHlKPIIIIIlliieSoaineiinnnnengnndegltNnwgatggiehirthsrnteottlitSeathhter tirteiwnllsBGaHiyl yl ei rtoragehrt tlliuaa Dnetos1arivvelvitnPtAezInl n nlu aee iaMeRfasCHl to t Acilvhh laaitootsirakn iioostciaiuuH1 n(tbnltccmuearpu tC1llle(i eeuetre tCeelT al To nUltm.i riornaLnnnaeeilorrnnbDnM afrrnausngae)f t trn trUe riarnUA � ainua,tist tti roanlsi a) PPPPPPPPPPPMPP0oe0"DpPOOOOORIRRROCRCMGGL'"VARPRRGA 2s/ EPEEEL I ASNCAB'HOSID FSS PFM S D EE S NA TL PPPPPPPPPPPPPDVOOO0ClOOPoOrorrrxurhruerrio�rblruKo�meilsieymleaelrsitieyeebtbireipaeqntrstfssscimcsgediitrdrraivn,atyeeeoueecharsetfo\orlaCth RaUaIGir yenlt tr trP yrn� dzeba oplraitGi reiuiyn ruaeltdduGamoelootoengSdrn.,i tnedreelaenbrcioofoloDr g d,h t a n� tutfPa aFdioett eAfnueSelieuschdiSle noy n o naellp uggnAsrAtn alAfNpniRl t aPrzstatapaeeislEeeiylvceotn m aman onirrt1 rS1 gnagtobltyu y H has1 i tnooeuACdnoLmsc nus ctrn eoallre S reocmteitoenr UUuTTTTITTIITTTGTITTTTTTTNMV/RPMVPWLLPIEsEELEEDCD CBAR IKRlMFRGMXCCl&A N M P E S UUUTTTTTTTTTTTTTTTCTTTTomnnrrherieerreeraemeoirwlrabidrannamnnaleennaapnnmargnritoun1ne5ienivnnefenpeioto lecsnss mnsnssrns sulEf fSidVktamleCaalipaa eusa orhI tCc e liatlluttoaPnPP tnr�glca ttr hniuesrhahh tnsotIlItiy ar itaraaCnCeiosnt eo erthsio sssoPsCrtseaOeo,rn ieeeoIaMrnrs a ieso / no A niis tstrtcuRitnpindtTsot ler npatat ildsco riloo n eo&a ungia tr L vcisMeloe Erln j e ction
0OOODDDDODODfElKU/CEP!APTF JBAG�L f fA S ' DDDDDDD[DDDeeii�\cieoegpacgtkttfsgdiilbttr'la ·efcr��aEtoal' �eeelnrii!ndtocrne nO ADrCP ncetsOaoyurr ctnn ITJilt baokolcie1npa Pn edotodliI d nDl rl no A i hs[1ts�sii eeSgpomirllbtntilaa iyA11yo s J En��� 11eyc1srbt1Tlrtiyl ml1e r lLLlLLLlLLLLHA/BBEAC[)FOGGT HRGBSHI C o K r lbslPLLLLlLlLLL ouaaeoowaaoMinuftnuewnc aGqnditBtdru-nrdm� iunhisui c alEdHdiaFg tnqeACahr oad Rud zno krr ia icoep Hi tmm lozeCeuer(ono tGtdiTn �mh wlBtn np.aan Mylue) tn te r QR'PPPP'PPt "WUTRU"IRy OG C PS RQRPPPPPPPorruowrroralor�loeopois/alnprgpneRils to rtBdetl na irally gXTontmul c�tXnhfa ea e UU1e nt t tni1 iM C lloiin tzzroaaltat niidooG nan g inSgy steT': WWWVVVvvVvRT/LIHAo TN0V Nf.x . UWWVIUV'I';'VeiSSeeanoitrl1NNro b�ceitho cSSy eer \.lRuH'hui ttK taeile y itsyag VieapnhFne,elg rgl·ec ut otqt�ocou r ile·t<ndync y
DataS torage [f]uipo,pnt LHUJ left-haEnqdui pment RA lldd&ait or XFER Tranfser
O(IDllS$Tf!lJ!1 , ''Y O[Di1igdsitapaillla UacyTpnrd ld� K trO yAl!l �>o�jdr.r,,d.c ,thnlcy LliHt0Sl1Sf1C( l\ LLli eet ffhttiHUi -" � hnHalySFnldiod od1 'P0SQ 1fXa(llrlq l\dru aa1ly�rnrm n pll\n�atiy n Pr RRCCSDD R RRReeea1cc:ootrCoidotoeCf�nro! nttrrlo·J1�on yli� te1·, XXMPIOTr-l,D fR lTrr��nn�spminotnr d T.r,arn �r·ittrr
Dnwn ;11� lLl �\ LnarL andinMgde1 S•5 lon 'R"C U Rr{irv cr 1 ,,.
r. ll{IS lu�nd.,,l,i r,1r�ekf Si�!.! l!StR1e5d tso ne
lrE[E�,�or rnr·otl·ovr·tf;(.•i,h.-,a ,,,lrtlL,n·•--lJl ••uoSllolzrbrc {�o"iil pnP Phrr InoP I ItlrnIiSet: trf y):rfis tfJ,r Pl .uI cit·p'n r •� d.Mlf' lllLL� MOON: I�I IIrG Lllllo1uuun"nnng"�a�Oi1rrrMNMrtr ocobu raridlrllteu·ull r1 lliror l": oi•"t' "\r ft •(,, F"�RRRfEfl"lQrG lOS :lT 'Ii\Rl�RT• r<·lig�·u•lufrar,c rtoh rfdmrt LSn -t.ch�>Pban l nP'r �l" "'M.Jtt•rrlr� """ c VVPtE>o�lsloi!octtciylo(CC tnhhhy JaJ nnfl.��'((OD1PrJI'foit ' nff �ffitln··Cr•.o t-1·rtn·ntnfl�f,1 �.l1)1 )
ll(�lanrcrttvtrh,hy·l1 oJ ·:..rtlu.-.t nIn odIr•1" S I yJ�dter •1 LLLPOROS LllLoiuasqnnshado trif rn �Ragiadr t�akrni anOlg lO'rb 'Lt uSo;1st r r>f �"'"'5 1c, 1: 1./ RRfk��col��l,l· Id·Jlh �1i , Jll u·e1d..:l\'bvY1 iIoOcl:uU'1��" t] ,.,,\J, 1",. ',t t,'•," CS�l1C A
li�l >•liOtl l IT li9ht1ng l-T ·i
r,,; ..r ,,, , · I,., ll .H ,1unrVle1i nl f' OJ( o,. C(
lite\ ,,,.,. \ul.•,, V I t
SECTIONI -GENRAEL
MSISIODNES CRTIINPO
l.L anucha ndE .P.(OD.au troin2 4:4)T -2:4G4E T
0
(a) Nomniall uancthmi ei s8 :3E2TS ,J ul1y6, 1 699,w itha luanch
windodwu rioanto f4 hsr.2 4m in.
(b) Eatrho brit isnetrino itnoa 10n0m c irculoarrbt iatl lm in.
24s eca.ft elri fto-ff
(c)C SMs ytsemCs/ 0i ne arh tobrit
(d)O potniaIlUM reainlg (5P2t)o t hep adR ESFMMAdTui rntgh fei rst
nighpte riod
(e) TLoI ccusr at2 4:4:1G8E To vret hPea fciic Ocaend uinrgt he
seocndr eovlutoin. (eSeT bal1el- for bunr dat)a.
2.T rnasulnaCro at s(uDraiotn7 3:112)4: 4-75:G5E5T
AfteTr L,Iw hihc placetsh es pcaecrafti na frelenu arre tunr trajetco
ry, thfeo llwoingm ajro evenotcsc purroi rt oL OI:
(a) Trnasposiinot,d ociknagn dL Me ejctoin,i cnludnigS IBV photo-
graphy
()b Sepraaitno froSmI BV anda CSMe vaisev manuever
(c)S IBV prouplsei vvetninogfp orepllan(tsislgn sh)o t
()d Twos eierso fP 23c silunarn avgiaotnis gihtnig,ss t/aerrathh ori
zo,n conistsign offie v setast 0 6:0G0E Ta ndf iev setast2 4:00
GET
(e) Foumrid ocurscoere rtcoinswh icht akpel ea actT LI + 9,T LI+ 24,
LOI 2-2a ndL OI- 5h osu writh�Vno mniallyz ero (SeTeab l1el- ).
(f)P assei tvhermaclo ntlr (oTPC)w illb ec onudcetdd urianllg p eriosd
wheont hre acvtiitiedson otr eqiuer differeantttt iueds.
()g LMi snepctoina ndh uoseeeknpig
(h)L OI,p erformde at7 5:5:530 GE,Te ndtsh eT LCp hsae.
1
1l-
3.L nuarO rbit (Duiroan5t 5:8 3)7 5:55 1-13:33 GET
LOI Day
()a LOI
1
(b)P hotoosf t argeotfos p ptourntyi
(c)L OI
2
(d)P ots LOILMe nrty ainsndep citno.T enm inuteosfV HF-BL BR
2
datwail lb et ramnitsetdt oC S/MDSEf or playbatcokM SF.N
(e)P osLtO IPseou ldnadmrakt raicnk(gno es eotf s gihtgisn)
2
(eSeT bal1e3 -)
(f)R ets peiordo f8 hosu r
4.D esceanntdL nadnigD ay( uDraiton2 3:489)4: 23 1-1:82G0E T
(a)D okceLd Ma cvtiatonia ndc hekcout
(b)D okcedln adnigs iet lnadmasrikg ihgnt (noes eot fs gihtgis)n
(eSeT abl1e3- )
(c)U ndcokniga nds pearaotn( ieSeF giuer 13- RendveozuPsr iofle)
(d)D OI thrul nadnig
(e)L Mp ostt oudcohwann ds miualteldfi toff
()f Restp eiord( LMo)f 4 hosu r
(g)C SMp lanec hange
(h)R estp eriod( SCM)o f4 hosu r
5. LUNAERX PORLAITNO D/IY( uDrtaino 10:301)90 3:0-12:0G0E T
(a)E AV prep
(b)E AV for h2ou rs4 0m inutes
(c) Pots EAV
(d)R estp eroid( ML)4 hosu r 4m0in utes
(e)R est'J eriod( CS4M h)o su r
.
6.L itf-Of,f Renzdveuos& TEI Day( uDrtaion1 :700)1 2:282 -1932:8G ET
(a)L ML fitO-ff andI nrsteoin
12-
Description:The Apollo 11 Flight Plan is under the configuration control of the Crew .. (b ) Earth orbi t i nsertion i nto a 100 nm ci rcul ar orbi t at l l min. 24 sec. afte