Table Of ContentWangetal.DiagnosticPathology2013,8:8
http://www.diagnosticpathology.org/content/8/1/8
RESEARCH Open Access
An analysis of Cyclin D1, Cytokeratin 5/6 and
Cytokeratin 8/18 expression in breast papillomas
and papillary carcinomas
Yu Wang, Jin-fu Zhu, Ying-ying Liu and Gui-ping Han*
Abstract
Background: Toevaluate theexpression levels of Cyclin D1in breast papillomas and papillary carcinomas, and to
analyze the types ofcells that co-express Cyclin D1with Cytokeratin 5/6 (CK 5/6)or withCytokeratin 8/18(CK 8/18).
Methods: Fifty-nine cases ofpapillary lesions including 36 papillomas and 23 intracystic papillary carcinomas were
examined. Cyclin D1, CK 5/6 and CK 8/18 expression levels were evaluated by double immunostaining.
Results: Cyclin D1is highlyexpressed inpapillary carcinomas (27.54%±15.43%) comparedwithpapillomas(8.81%±
8.41%,p<0.01).CyclinD1ispredominantlyexpressedinCytokeratin8/18-expressingcells,ratherthaninCytokeratin
5/6-expressingcells,regardlessofthetypeoflesion.InPapillomas,CyclinD1exhibitedamean11.42%(11.42%±
10.17%)co-expressionratewithCytokeratin8/18comparedwithamean2.50%(2.50%±3.24%)co-expressionrate
withCytokeratin5/6(p<0.01).Inpapillarycarcinomas,CyclinD1exhibitedamean34.74%(34.74%±16.32%)
co-expressionratewithCytokeratin8/18comparedwithaco-expressionrateof0.70%(0.70%±0.93%)withCytokeratin
5/6(p<0.01).
Conclusions:TheincreaseinCyclinD1suggestsanassociationofCyclinD1stainingwithpapillarycarcinomas.
AlthoughCyclinD1isaneffectivemarkerforthedifferentialdiagnosisofotherpapillarylesions,itcannotbeusedto
distinguishbetweenpapillomaandpapillarycarcinomalesionsbecauseitsexpressionoccursinbothlesions.Our
resultsshowthatCyclinD1andCK5/6stainingcouldbeusedinconcerttodistinguishbetweenthediagnosisof
papilloma(CyclinD1<4.20%,CK5/6positive)orpapillarycarcinoma(CyclinD1>37.00%,CK5/6negative).Inaddition,
ourdatasuggestthatCyclinD1isexpressedonlyinthecancerstemorprogenitorcellsthatco-immunostainedwith
CK8/18inpapillarycarcinomas,andpredominantlywithCK8/18inthepapillomas.
Virtualslides:Thevirtualslide(s)forthisarticlecanbefoundhere:http://www.diagnosticpathology.diagnomx.eu/vs/
7299340558756848
Keywords:CyclinD1,Cytokeratin,Papillarycarcinoma,Papilloma,Doubleimmunostaining
Background characteristics [1]. The key histological feature used
Papillary breast tumors consist of proliferative mammary to delineate benign papilloma from papillary DCIS is
epithelial cells that invade the ductal lumen and form the presence of myoepithelial cells, which is preserved
fibro-vascular stalks that may evolve into branching arbo- in the former and scant or absent in the latter. CK 5/6,
rescent structures. Intraductal papillomas and papillary SMA(smoothmuscleactin)andp63aregenerallyaccepted
ductalcarcinomasinsitu(DCIS) are examplesofpapillary markers for the differential diagnosis of papillomas and
breast lesions. Despite the well-described histological fea- papillarycarcinomas[2].
turesofthesetwotumors,itisoccasionallydifficulttodis- In recent years, the elevated expression of Cyclin D1
tinguishbetweenthembecauseofoverlappingmicroscopic in papillary carcinomas compared with papillomas has
attractedsignificantattention.Severalstudieshavereported
*Correspondence:[email protected]. thatCyclinD1expressionlevelsaresufficientlysensitiveto
DepartmentofPathology,The2ndaffiliatedhospitalofHarbinMedical distinguishbetweenthesetwotypesoflesions[3].Whether
University,XuefuRoad246,Harbin,NanggangDistrict,China
©2013Wangetal.;licenseeBioMedCentralLtd.ThisisanOpenAccessarticledistributedunderthetermsoftheCreative
CommonsAttributionLicense(http://creativecommons.org/licenses/by/2.0),whichpermitsunrestricteduse,distribution,and
reproductioninanymedium,providedtheoriginalworkisproperlycited.
Wangetal.DiagnosticPathology2013,8:8 Page2of7
http://www.diagnosticpathology.org/content/8/1/8
these two types of lesions can be distinguished by Cyclin All tissues were fixed in a 10% formalin solution. Four
D1 expression levels alone requires further investigation. micron-thick serial sections were generated from paraffin-
Moreover, the mechanism underlying the elevated expres- embedded blocks. For epitope retrieval, the slides were
sionofCyclinD1inbreastcarcinomasremainsunknown. boiled in a cooker in EDTA buffer pH 9.0 for 20 minutes.
Cyclin D1 is a cell -cycle regulator that is essential for Next, the sections were incubated with the Cyclin D1
progression through G1 phase and is a candidate proto- primary antibody over-night at 4 degrees centigrade. The
oncogene. This protein has also been implicated in the remaining steps of the procedure were performed accor-
pathogenesis of several human tumor types including ding to the manufacturer’s recommended protocol. The
breast carcinomas. To the best of our knowledge, there sections were visualized by incubation in BCIP/NBT for
arenoavailablepublishedstudiesregardingtheexpression 30 minutes at room temperature. The nuclei of cells that
of Cyclin D1 in different breast cell types. Moreover, the expressedCyclinD1werestainedblack.
use of Cyclin D1 alone to make a differential diagnosis Next, the sections were treated with Amplifer for
between papilloma and papillary carcinoma remains a 10 minutes, incubated in 10% normal goat serum for
controversialtopic.Inthisstudy,weaimedtoevaluatethe 30 minutes at room temperature, and incubated with a
expression of Cyclin D1 in different cell types and to second primaryantibody toeitherCK5/6 or CK8/18for
assess its potential to distinguish between papillomas and 1 hour at room temperature. The remaining steps of the
papillarycarcinomasusingadoubleimmunostainingtech- procedures were performed according to the manufac-
nique. Cells expressing CK 5/6 or CK 8/18 exhibited pale turer’s recommended protocol. The sections were visua-
red or red-stained cytoplasm, whereas cells expressing lized using a cocktail of AEC Buffer, AEC Substrate and
CyclinD1exhibitedablacknuclearstainingpattern. AEC Chromogen for 10 minutes at room temperature.
The cytoplasm of CK 5/6 or CK 8/18-expressing cells
appeared pale red or red after staining. Hematoxylin was
Methods used as a counter stain, and the nuclei were thus stained
We examined 59 papillary breast lesions (Table 1) from blue-purple,unlessthenucleiwerepositiveforCyclinD1:
the database of the Department of Pathology of the 2nd inthosecases,thenucleiwerestainedblack.
affilliated hospital of Harbin Medical University, inclu- Next,CyclinD1,CK5/6orCK8/18stainingwasclassi-
ding 36 cases of intraductal papillomas and 23 cases of fied as either negative or positive for each antibody. Five
intracystic papillary carcinomas. All of the diagnoses fields were selected randomly at magnification of 400×.
were made with Cytokeratin 5/6, SMA, p63, CD10 The number of Cyclin D1 expressing cells and, CK 5/6 or
and calponin. CK 8/18 co-expressing cells was quantified – out of 200
Double immunostaining analyses were performed. The cells for every selected field. The mean expression rate of
tissuesweresectionedintosequentialslices(twoserialsec- Cyclin D1 was calculated. Data were analyzed using the
tions were cut from each block, specifically, one for Cyclin SPSS13.0softwarepackage(IBM,Armonk,NY,USA)and
D1andCK5/6staining,andoneforCyclinD1andCK8/ presented as X(cid:1)±SD. The Mann–Whitney U test was used
18staining).Initialimmunostainingwasperformedusinga to analyze discrepancies. P-values<0.01 were considered
Cyclin D1 antibody purchased from QuanHui (Beijing, tobestatisticallysignificant.
China),andaCytokeratin5/6(CK5/6)orCytokeratin8/18
(CK 8/18) antibody, both of which were purchased from
MaximBio(Fuzhou,Fujian,China).Eachprimaryantibody Results
wasappliedatafinaldilutionof1:50.TheMaximDouMax We detected negligible levels of Cyclin D1 expression
Visiontm kit was purchased from Maxim Bio, which within papilloma sections (shown in Figure 1A, B) com-
included Endogenous Peroxidase Blocking Solution, pared with high levels of Cyclin D1 expression in papil-
Non-Immune Serum, Biotinylated Secondary Antibody, lary carcinomas (shown in Figure 1C, D). In keeping
Streptavidin Alkaline Phosphatase, BCIP/NBT, Amplifer, withtheseresults,themeanrateofCyclinD1expression
Streptavidin Peroxidase, AEC Buffer, AEC Substrate, AEC in the papillomas was 8.81% (8.81%±8.41%), whereas
Chromogen,Hematoxylin,andClearMount. the mean expression rate of Cyclin D1 in the papillary
carcinomas exhibited a statistically significant increase
to27.54% (27.54%±15.43%,p<0.01,Figure2).
Table1Thedistributionofthedifferentagegroupsof
patientswithpapillarylesions In our study, the rate of Cyclin D1 expressioninpapil-
loma cells was 0-37%, whereas the rate of Cyclin D1
Age(year) Papilloma Papillarycarcinoma
expression in papillary carcinoma cells was 4.20%-60.80%.
16-39(mean29.5) 11 2
Although there was overlap in Cyclin D1 expression
40-59(mean45.5) 19 16
between these two lesions, a small number of papilloma
60-76(mean67.4) 6 5
cases exhibited higher Cyclin D1 expression than the
Wangetal.DiagnosticPathology2013,8:8 Page3of7
http://www.diagnosticpathology.org/content/8/1/8
Figure1ImmunohistochemicaldoublestainingforCyclinD1andCK5/6orCK8/18inpapilloma(AB,originalmagnification×200;a
b,originalmagnification×400)andinpapillarycarcinoma(CD,originalmagnification×200;cd,originalmagnification×400).The
cytoplasmofthecellsexpressingCK5/6isstainedpaleredandCK8/18wasstainedred,whereasthecytoplasmofcellsexpressingCK8/18is
stainedred.ThenucleiofCyclinD1positivecellsarestainedblack.(A,a)ImmunohistochemicaldoublestainingforCyclinD1andCK5/6ina
papilloma.TheCyclinD1positivecellswerehardlydetectedin(A).(B,b)ImmunohistochemicaldoublestainingforCyclinD1andCK8/18ina
papilloma.TherewereafewCyclinD1positivecellsdetectedin(B).Uponcomparing(a)and(b),CyclinD1expressionisclearinthecellsthat
arepositiveforCK8/18incontrasttothecellsthatarepositiveforCK5/6inthepapillomas.(C,c)Immunohistochemicaldoublestainingfor
CyclinD1andCK5/6inpapillarycarcinoma.ThecellsarenotimmunoreactiveforCK5/6.(D,d)ImmunohistochemicaldoublestainingforCyclin
D1andCK8/18inpapillarycarcinomas.CyclinD1(D)localizesinpracticallythesamepositioncomparedwith(C).ThenumberoftheCyclinD1
positivecells(C,D)clearlyincreases,incontrastto(A)and(B).Asinthepapillomas,CyclinD1onlyappearsinthecellsthatco-expressCK8/18.
average Cyclin D1 expression of the papillary carcinomas exclusively expressed in the cells that co-expressed CK 8/
andviceversa,theCyclinD1togetherwithCK5/6staining 18,whereasCK5/6isalmostneverexpressedinthepapil-
could be used to distinguish between papillary carcinoma larycarcinomas(Figure1c,d).Themeanco-expressionrate
and papilloma samples. Statistical analysis indicated that ofCyclinD1withCK8/18is34.74%(34.74%±16.32%),and
Cyclin D1 expression could distinguish papilloma from the mean co-expression rate of Cyclin D1 with CK 5/6 is
papillary carcinoma (p<0.01). If the percentage of the 0.70% (0.70%±0.93%, p<0.01, Figure 3), indicating that
CyclinD1expressionwasover37.00%andnegativeforCK the overexpression of Cyclin D1 is significantly correlated
5/6expression,adiagnosisofpapillarycacinomawasmade. withcellsexpressingCK8/18.
Conversely, if the percentage of the Cyclin D1 expression
was below 4.20% and posirive for CK 5/6 expression, a Discussion
diagnosisofpapillomawasmade. Stem cells found within the breast tissue have the ability
In the papillomas, Cyclin D1 was predominantly ex- to self-renew and generate daughter cells, including all
pressed in CK 8/18 positive cells with limited expression of the cell types found in mature breast tissues [4].
CK5/6positivecells(showninFigure1a,b).Themeanco- Multi-potent mammary stem cells (MaSCs) produce
expression rate of Cyclin D1 with CK 8/18 was 11.42% committed progenitors, which subsequently differentiate
(11.42%±10.17%), whereas the mean co-expression rate of into myoepithelial and luminal epithelial cells [4].
CyclinD1withCK5/6was2.50%(2.50%±3.24%,p<0.01, During the differentiation process, the self-renewal
Figure 3). Thus, there is a statistically significant difference capacity of the cells is gradually lost. Of the MaSCs
intheco-expressionratesofCyclinD1andCK8/18orCK and the committed progenitors, it is believed that at
5/6 between these two lesion types. Cyclin D1 was almost least one is a bi-potent progenitor. These progenitors,
Wangetal.DiagnosticPathology2013,8:8 Page4of7
http://www.diagnosticpathology.org/content/8/1/8
Figure2ThemeanexpressionrateofCyclinD1inthepapillomasandthepapillarycarcinomas.TheexpressionrateofCyclinD1is
27.54%±15.43%inpapillarycarcinomasand8.81%±8.41%inpapillomas(p<0.01).ThevaluesareexpressedasX(cid:1)±SD.*P<0.01(Mann–WhitneyU
test).Thedifferenceexhibitedclearstatisticalsignificance.
which include bi-potent progenitors, all express basal differentiation and only produce tumors with features of
markers, such as CK5, CK6, and CK14 [5]. In a particular lineage, including luminal or basal like
addition to those progenitors previously mentioned, lineages. Regardings to tumor heterogeneity, there still
the luminal progenitors also express such markers as remains controversy. Current explanations comprise two
CK8 and CK18. Consequently, the existence of a lu- predominant models: the cancer stem cell hypothesis
minal progenitor population has been identified [6], and the clonal evolution and selection hypothesis.
but the myoepithelial progenitor could not be identified According to the clonal evolution hypothetical model,
because the progenitors also express basal markers, simi- tumorcellphenotypesaredeterminedbythephenotypeof
lar to MaSCs [4]. Myoepithelial progenitors differentiate the original cell type of the tumor-initiating cell. In this
into the myoepithelial cells, and luminal progenitors dif- study, papillary carcinoma cells expressing CK 8/18 should
ferentiate into cells that are restricted to either ductal or be differentiated from one cancer stem cell/progenitor of
alveolar lineages. The terminal luminal epithelial cells or luminal cell lineage, and accordingly, the luminal progeni-
alveolar cells lose the basal markers, expressing only CK8 tororterminalcellsshouldexpressthesamemarkers.This
andCK18,whereastheterminalmyoepithelialcellsmain- phenomenon would explain the clonal evolution of papil-
taintheexpressionof basalmarkersCK5,CK6,CK14and lary carcinomas. In our study, the papilloma masses con-
the new myoepithelial marker P63, SMA (smooth muscle sisted of cells that were positive for CK 5/6 and CK 8/18,
actin),andcalponin. clearly indicating that these cells originated from different
These findings form the basis of the cancer stem cell tumor stem/progenitor cells. Taken together, the two
(CSC) hypothesis, which posits that certain tumors are models indicate that the cellular phenotypes are unstable
initiated by one or more self-renewing CSCs that diffe- and can change as the tumor evolves. The heterogeneity
rentiate into large populations of non-self-renewing but of the papilloma cells can be considered to characterize a
rapidly dividing, cells which are responsible for genera- stage of the tumor progression, specifically, a competition
ting the tumor mass [7]. The cancer stem cells could amongtumorcellswithdifferentphenotypes.Itispossible
potentially be derived from bi-potent stem cells or from thatcertainpapillarycarcinomasderivedfromthepapillo-
more differentiated cells that have acquired self-renewal mas might result from the CK 8/18-positive tumor cells
capabilities. In contrast to the normal stem cells, the thatreplacetheCK5/6positivecells.Thetwomodelsare
cancer stem cells lose their capacity for multi-directional complementary in explaining tumor heterogeneity and
Wangetal.DiagnosticPathology2013,8:8 Page5of7
http://www.diagnosticpathology.org/content/8/1/8
Figure3Themeanco-expressionrateofCyclinD1withCK5/6orCK8/18inpapillomaandpapillarycarcinomacells.Themean
co-expressionrateofCyclinD1withCK8/18was11.42%±10.17%,andthatwithCK5/6was2.50%±3.24%(p<0.01);whereasinpapillary
carcinomas,themeanco-expressionrateofCyclinD1withCK8/18was34.74%±16.32%,andthatwithCK5/6was0.70%±0.93%(p<0.01).
ThevaluesareexpressedasX(cid:1)±SD.*P<0.01(Mann–WhitneyUtest).Thedifferencesexhibitedstatisticalsignificance.
progression. However, the hypothesis that the papillary During maturation of the breast cell, the differentiation
carcinoma cells could be derived from the papilloma and proliferative behaviors are regulated by a series of
cells which have the same progenitor of the cancer signaling pathways, such as the Notch [10], Hedgehog
cells, requires further research. However, the validity [11],andWnt[12]pathways.TheCCND1geneencodesa
of the explanation above regarding tumor progression subunit of the Cyclin D1 holoenzyme, which can phos-
remains to be confirmed. phorylate and inactivate pRB and NRF1 to regulate
In our results, Cyclin D1 staining was predominantly nuclear synthesis and mitochondrial biogenesis [13-17].
detectedinthecellsthatwerealsoimmunoreactiveforCK The biological effects of Cyclin D1 overexpression in the
8/18 in either the papillary carcinomas or papillomas. Pre- process of tumorigenesis are exhibited through the path-
viousstudieshavedemonstratedacorrelationbetweenCyc- waysmentionedabove.Severalstudieshavedemonstrated
lin D1 over-expression and breast cancers. The hypothesis thatthedisruptedregulationofthesepathwayscanleadto
that papillary carcinoma cells could be derived from papi- the development of breast cancer in mice [18-21] and in
lloma cells which have the same progenitors as the cancer humans[22-24].Onereportindicatedthatdeletionofthe
cellsmightbeexplainedbytheexpressionpatternofCyclin CCND1geneleadstofailedmammaryglanddevelopment
D1incellsco-expressingCK8/18. in mice [25]. Another study demonstrated that overex-
Cyclin D1, one of the protein mediators of the G1/ S pressionoftheCyclinD1oncogenecaninducemammary
cell-cycle transition, is commonly altered in breast cancer gland tumors in mice [26]. These findings further suggest
and contributes to tumorigenesis, presumably by increa- that Cyclin D1 might directly or indirectly triggerthe dif-
sing proliferation [8]. It is generally accepted that the ini- ferentiation of mammary glandular cells. Other studies
tiation of most tumors is triggered by chromosomal have suggested that Cyclin D1 might inhibit the differen-
instability (CIN), which is characterized by chromosomal tiation of adipocytes [8]. In addition, many studies have
abnormalitiesandanalteredgeneexpressionprofile.Data indicated that high Cyclin D1 expression levels correlate
fromMathewetal.[9]suggestthatCyclinD1contributes withCIN,specificallyintheluminalBsubtypetumors[9].
to CIN and tumorigenesis by directly regulating a tran- Thisphenomenonprovidesapossibleexplanationforwhy
scriptional program that governs chromosomal stability. CyclinD1wasmainlyexpressedinthecellsthatexpressed
Wangetal.DiagnosticPathology2013,8:8 Page6of7
http://www.diagnosticpathology.org/content/8/1/8
CK 8/18 but not in those that expressed CK 5/6. Cyclin DepartmentofPathologyofthe2ndAffiliatedHospitaloftheHarbin
D1 over-expression leads to the sustained proliferation of MedicalUniversity.
mammaryepithelialcells,whichisassociatedwithadelay
Received:20December2012Accepted:15January2013
inacinardevelopmentinvitromodels[27]andafailureto Published:18January2013
undergo terminal differention in mouse models [28]. The
cells in either the papillomas or the papillary carcinomas References
that expressed CK 8/18 could be derived from the same 1. TanPH,AwMY,YipG,etal:Cytokeratinsinpapillarylesionsofthebreast:
istherearoleindistinguishingintraductalpapillomafrompapillary
cancerstem/progenitorcells,whichexhibitthecapacityof ductalcarcinomainsitu?AmJSurgPathol2005,29(5):625–632.
self-renewal and strictluminaldifferentiation,andwhich 2. TseGM,TanPH,MoriyaT,etal:Theroleofimmunohistochemistryinthe
over-express Cyclin D1 proteins because of various differentialdiagnosisofpapillarylesionsofthebreast.JClinPathol2009,
62(5):407–413.
genetic or epigenetic events. The distinct expression
3. SaddikM,LaiR,MedeirosL,etal:DifferentialexpressionofcyclinD1in
patterns of Cyclin D1 between the papillomas and papil- breastpapillarycarcinomasandbenignpapillomas:an
lary carcinomas might be explained by their occurrence immunohistochemicalstudy.ArchPatholLabMed1999,123(2):152–156.
4. MaciasH,HinckL:Mammaryglanddevelopment.WileyInterdiscipRevDev
duringdifferentstagesoftumorigenesis. Biol2012,1(4):533–557.Epub2012Apr4.
5. YenidunyaS,etal:Predictivevalueofpathologicaland
immunohistochemicalparametersforaxillarylymphnodemetastasisin
Conclusions
breastcarcinoma.DiagnPathol2011,6:18.
In this study, we evaluated the levels of Cyclin D1 expres- 6. Asselin-LabatML,SutherlandKD,BarkerH,etal:Gata-3isanessential
sioninCK5/6-orCK8/18-positivecellsfrombreastpapil- regulatorofmammary-glandmorphogenesisandluminal-cell
differentiation.NatCellBiol2007,9(2):201–209.
lomaandpapillarycarcinoma.Doubleimmunostainingwas
7. VisvaderJE:Cellsoforiginincancer.Nature2011,469(7330):314–322.
usedtoanalyzethetypesofcellsthatco-expressCyclinD1 8. CaldonCE,SutherlandRL,MusgroveE:Cellcycleproteinsinepithelialcell
with CK 5/6 or CK 8/18. Increased levels of Cyclin D1 are differentiation:implicationsforbreastcancer.CellCycle2010,
9(10):1918–1928.
associated with inreased likehood of papillary carcinomas.
9. CasimiroMC,CrosariolM,LoroE,etal:ChIPsequencingofcyclinD1
This study also demonstrated the usefullness of CK 5/6 in revealsatranscriptionalroleinchromosomalinstabilityinmice.JClin
distinguishing breast papilloma (Cyclin D1<4.20%) from Invest2012,122(3):833–843.
10. FarnieG,ClarkeRB:Mammarystemcellsandbreastcancer—roleof
papillary carcinoma (Cyclin D1>37.00%). During the
Notchsignalling.StemCellRev2007,3(2):169–175.
differentiation of breast cells, various immunochemical 11. VisbalAP,LewisMT:Hedgehogsignalinginthenormalandneoplastic
markers appeared or disappeared at different time-points. mammarygland.CurrDrugTargets2010,11(9):1103–1111.
12. WendP,HollandJD,ZieboldU,BirchmeierW:Wntsignalinginstemand
In our results, Cyclin D1 was almost exclusively expressed
cancerstemcells.SeminCellDevBiol2010,21(8):855–863.
inthetumorcellsstainedbyCK8/18,whichisamarkerof 13. WeinbergRA:Theretinoblastomaproteinandcellcyclecontrol.Cell1995,
luminal cells in normal breast during development 81(3):323–330.
14. KatoJ-Y,MatsushimeH,HiebertSW,EwenME,SherrCJ:Directbindingof
into the final luminal format. We therefore conclude
cyclinDtotheretino-blastomageneproduct(pRb)andpRb
that Cyclin D1 is expressed exclusively in the cancer phosphorylationbythecyclinD-dependentkinaseCDK4.GenesDev
stemorprogenitorcellsthatpositivelyco-immunostained 1993,7(3):331–342.
15. EwenME,SlussHK,SherrCJ,etal:Functionalinteractionsofthe
for CK 8/18 in papillary carcinomas and predominantly
retinoblastomaproteinwithmammalianD-typecyclins.Cell1993,
forCK8/18thepapillomalesions. 73(3):487–497.
16. SakamakiT,CasimiroMC,JuX,etal:CyclinD1determinesmito-chondrial
Abbreviations functioninvivo.MolCellBiol2006,26(14):5449–5469.
CK5/6:Cytokeratin5/6;CK8/18:Cytokeratin8/18;DCIS:Ductalcarcinomasin 17. WangC,LiZ,LuY,etal:CyclinD1repressionofnuclearrespiratoryfactor
situ;MaSCs:Multipotentmammarystemcells;SMA:Smoothmuscleactin; 1integratesnuclearDNAsynthesisandmitochondrialfunction.ProcNatl
CSC:Cancerstemcell;CIN:Chromosomalinstability. AcadSciUSA2006,103(31):11567–11572.
TheProjectFund:theScientificResearchFoundationfortheReturned 18. VorechovskyI,BenediktssonKP,ToftgårdR:Thepatched/hedgehog/
OverseasChineseScholars,StateEducationMinistry(2009–1001). smoothenedsignallingpathwayinhumanbreastcancer:Noevidence
forH133YSHH,PTCHandSMOmutations.EurJCancer1999,
35(5):711–713.
Competinginterests
19. SorianoJV,UyttendaeleH,KitajewskiJ,etal:Expressionofanactivated
Theauthorsdeclarethattheyhavenocompetinginterests.
Notch4(int-3)oncoproteindisruptsmorphogenesisandinducesan
invasivephenotypeinmammaryepithelialcellsinvitro.IntJCancer
Authors’contributions 2000,86(5):652–659.
YWandJZcarriedouttheexperimentsandanalysisofresultsobtained.All 20. HuelskenJ,VogelR,BrinkmannV,etal:Requirementforbeta-cateninin
authorsparticipatedinthedesignofthestudy,analysisofobtainedresults. anterior-posterioraxisformationinmice.JCellBiol2000,148(3):567–578.
YWdraftedthemanuscript.Allauthorshavereadandapprovedthefinal 21. KellyOG,PinsonKI,SkarnesWC:TheWntco-receptorsLrp5andLrp6are
manuscript. essentialforgastrulationinmice.Development2004,131(12):2803–2815.
22. PascaDiMaglianoM,HebrokM:Hedgehogsignallingincancerformation
Acknowledgements andmaintenance.NatRevCancer2003,3(12):903–911.
WearegratefultoJinLiu,Ming-mingChuandKe-feiWufortheirexcellent 23. KarhadkarSS,BovaGS,AbdallahN,etal:Hedgehogsignallinginprostate
technicalassistanceinmakingsections.Thisstudywassupportedbythe regeneration,neoplasiaandmetastasis.Nature2004,431(7009):707–712.
Wangetal.DiagnosticPathology2013,8:8 Page7of7
http://www.diagnosticpathology.org/content/8/1/8
24. LiuS,DontuG,WichaMS,etal:Mammarystemcells,self-renewal
pathways,andcarcinogenesis.BreastCancerRes2005,7(3):86–95.
25. FantlV,StampG,AndrewsA,etal:MicelackingcyclinD1aresmalland
showdefectsineyeandmammaryglanddevelopment.GenesDev1995,
9(19):2364–2372.
26. WangTC,CardiffRD,ZukerbergL,etal:Mammaryhyperplasiaandcarci-
nomainMMTV-cyclinD1transgenicmice.Nature1994,
369(6482):669–671.
27. DebnathJ,MillsKR,CollinsNL,etal:Theroleofapoptosisincreatingand
maintainingluminalspacewithinnormalandoncogene-expressing
mammaryacini.Cell2002,111(1):29–40.
28. GaddM,PiscC,BrandaJ,etal:RegulationofCyclinD1andp16INK4AIs
criticalforgrowtharrestduringmammaryinvolution.CancerRes2001,
61(24):8811–8819.
doi:10.1186/1746-1596-8-8
Citethisarticleas:Wangetal.:AnanalysisofCyclinD1,Cytokeratin5/6
andCytokeratin8/18expressioninbreastpapillomasandpapillary
carcinomas.DiagnosticPathology20138:8.
Submit your next manuscript to BioMed Central
and take full advantage of:
• Convenient online submission
• Thorough peer review
• No space constraints or color figure charges
• Immediate publication on acceptance
• Inclusion in PubMed, CAS, Scopus and Google Scholar
• Research which is freely available for redistribution
Submit your manuscript at
www.biomedcentral.com/submit