Table Of ContentACI
MATERIALS
JOURNAL
INDEX VOLUME 107, 2010
From a Journal of the American Concrete Institute, January through December 2010
>
a4\
American Concrete Institute®
Advancing concrete knowledge
AMERICAN CONCRETE INSTITUTE, Farmington Hills, Michigan
ACI Materials Journal/March-April 2011
IND) =,
ACI Materials Journal VOLUME 107, 2010
Alkali-silica reaction
Remove this section and include it with your January through
—Correlation of Reaction Products and Expansion Potential in Alkali-
December 2010 Volume 107 issues of the AC/ Materials
Silica Reaction for Blended Cement Materials (107-M44) Bonakdar, A.;
Journal. Mobasher, B.; Dey, S. K.; and Roy, D. M., July-Aug. 2010 ........ 380
—lInvestigation of Alkali-Silica Reaction Inhibited by New Lithium
Compound (107-M06) Mo, X.; Zhang, Y.; Yu, C.; Deng, M.; Tang, M.;
A
Hiinger, K.-J.; and Fournier, B., Jan.-Feb. 2010...................37
Alternative cementitious material Synergistic Effect between Glass Frit
Accelerated hydration Potential Approach to Evaluating Soundness of and Blast-Furnace Slag (107-M11) Laldji, S.; Phithaksounthone, A.; and
Concrete Containing MgO-Based Expansive Agent (107-M13) Mo, L.; Tagnit-Hamou, A., Jan.-Feb. 2010 . .
Deng, M.; and Tang, M., Mar.-Apr. 2010 wi ssc iaectae aoa Aluminosilicate Effect of Mixture Compositions on Workability and
Accelerated test Design and Research on Gradient Guemen Concrete Strength of Fly Ash-Based Inorganic Polymer Mortar (107-M62) Wu, H.-C.,
Based on Volumetric Stabilization (107-M69) Wen, X.-D.; Ma, B.-G.; and Sun, P., Nov.-Dec. 2010. .
Gan, W.-Z.; and Xian, Z.-W., Nov.-Dec. 2010 ey . 611 Amplitude factor Characterization of Deep Surface-Opening Cracks in
Accelerometer Compacted Sand Concrete in Pavement Construction: An Concrete: Feasibility of Impact-Generated Rayleigh-Waves (107-M36)
Economical and Environmental Solution (107-M24) El Euch Khay, S.; Chai, H. K.; Momoki, S.; Aggelis, D. G.; and Shiotani, T., May-June
Neji, J.; and Loulizi, A., Mar.-Apr. 2010 a 195 2010
Active protection Corrosion Protection of Fiber- Reinforced Polymer- Analysis ofM ortar Long-Term Strength with Supplementary Cementitious
Wrapped Reinforced Concrete (107-M40) Gadve, S.; Mukherjee, A.; and Materials Cured at Different Temperatures (107-M37) Ezziane, K.;
Malhotra, S. N., July-Aug. 2010... 349 Kadri, E.-H.; Bougara, A.; and Bennacer, R., July-Aug. 2010. ..... . 323
Admixture(s) Anderson, M. A. Detection of Aggregate Clay Coatings and Impacts on
—Effect of Calcium Chloride and Initial Curing Temperature on Expansion Concrete (107-M45) July-Aug. 2010 ...............2022-0000-- 387
Caused by Sulfate Exposure (107-M72) Kosbab, B. D., and Kurtis, K. E., Andion, L. G. Triple Percolation in Concrete Reinforced with Carbon Fiber
Nov.-Dec. 2010 : iis a (107-M46) July-Aug. 2010 . ate n'a tie gt alsa elei te as ren eae
—Effects of Hauling Time on Air- Entrained Self- co nsolidating Concrete Ann, K. Y.
(107-M32) Ghafoori, N., and Barfield, M., May-June 2010. . . . 275 —Critical Corrosion Threshold of Galvanized Reinforcing Bars (Disc. 106-M22)
Aggelis, D. G. Jan.-Feb. 2010
—Characterization of Deep Surface-Opening Cracks in Concrete:
Feasibility of Impact-Generated Rayleigh-Waves (107-M36) May-June CF Coe re EE, BOO ccicbacewsc eounucessennd e
2010 ; 305 Anodic current Corrosion Protection of Fiber-Reinforced Polymer-
—Numerical Simulation of Stress Waves on Surface of Strongly Heterogeneous Wrapped Reinforced Concrete (107-M40) Gadve, S.; Mukherjee, A.; and
Media (107-M53) Sept.-Oct. 2010 469 oe eeee e ee
Aggregate(s) Artificial Neural Network Modeling of Early-Age Dynamic Young’s
—Artificial Neural Network Modeling of Early-Age Dynamic Young’s Modulus of Normal Concrete (107-M33) Venkiteela, G.; Gregori, A.;
Modulus of Normal Concrete (107-M33) Venkiteela, G.; Gregori, A.; Sun, Z.; Sun, Z.; and Shah, S. P.. May-Jume 2010... cece cccr ences s O00
and Shah, S. P., May-June 2010 . -2 82 Asphalt emulsion Temperature Stability of Compressive Strength of
—Effect of Aggregate Type on Mechanical Properties of Reactive Powder Cement Asphalt Mortar (107-M04) Wang, F.; Liu, Z.; Wang, T.; and Hu, S.,
Concrete (107-MS0) Aydin, S.; Yazici, H.; Yardimci, M. Y.; and Yigiter, H., Jan.-Feb. 2010.
Sept.-Oct. 2010.......... nani eee Assessing Mechanical Properties and Microstructure of Fire-Damaged
—Effect of Curing Methods on pategpenes Siuteings ond Self-Induced Engineered Cementitious Composites (107-M35) Sahmaran, M.;
Stresso f High-Performance Concrete (107-M10) Meddah, M. S., and Sato, R., Lachemi, M.; and Li, V. C., May-June 2010
Jan.-Feb. 2010... .... 65 Attenuation
Aggregate gradation Effect of Aamaaue Size and Gradation on Salons —Characterization of Deep Surface-Opening Cracks in Concrete: Feasibility
Concrete Mixtures (107-M71) Neptune, A. I., and Putman, B. J., Nov.-Dec. of Impact-Generated Rayleigh-Waves (107-M36) Chai, H. K.; Momoki, S.;
2010 , ie 625 Aggelis, D. G.; and Shiotani, T., May-June 2010
Air entrainment Effects of Hauling Time on Air-Entrained Self- —Wavelet Analysis of Ultrasonic Pulses in Cement-Based Materials (107-M29)
Consolidating Concrete (107-M32) Ghafoori, N., and Barfield, M., PUREE TE, Bac IE NO cis cec ciaae daacarrkanyececni s 248
May-June 2010 . eisisats dp Ney Autoclave Effect of Aggregate Type on Mechanical Properties of Reactive
Air void Effects of Hauling Time o« n Air- Entrained Self-Consolidating Powder Concrete (107-M50) Aydin, S.; Yazici, H.; Yardimci, M. Y.; and
Concrete (107-M32) Ghafoori, N., and Barfield, M., May-June 2010 . . . 275 Yigiter, H., Sept.-Oct. 2010
Akalin, O. Self-Consolidating High-Strength Concrete Optimization by Autogenous shrinkage Shrinkage of Precast, Prestressed Self-Consolidating
Mixture Design Method (107-M41) July-Aug. 2010 Concrete (107-M27) Khayat, K. H., and Long, W. J., May-June
Akay, K. U. Self-Consolidating High-Strength Concrete Optimization by
Mixture Design Method (107-M41) July-Aug. 2010... . ee Aydin, S. Effect of Aggregate Type on Mechanical Properties of Reactive
Alaejos, P. Models for Chloride Diffusion Coefficients of Concretes in Powder Concrete (107-M50) Sept.-Oct. 2010 ..
Tidal Zone (107-M01) Jan.-Feb. 2010 i onan
Alexander, M. G. Suitability of Various Measurement Techniques
for Assessing Corrosion in Cracked Concrete (107-M55) Sept.-Oct.
2010. ts a . 481 Baeza, F. J. Triple Percolation in Concrete Reinforced with Carbon Fiber
Al Jadiri, R. s. New Method for Pespertening Self-C onsolidating I aa TD, ....w oss sunita ceusenssvdibuoscesss 396
Concrete Based on Compressive Strength Requirements (107-M56) Barfield, M. Effects of Hauling Time on Air-Entrained Self-Consolidating
Sept.-Oct. 2010 490 Concrete (107-M32) May-June 2010 .....22..... e.e ee. ee.e e ee 275
Alkali-aggregate reaction Reventigntion of Alkali-S ilica Reaction Inhibited Basu, P. C.
by New Lithium Compound (107-M06) Mo, X.; Zhang, Y.; Yu, C.; Deng, M.; —New Methodology to Proportion Self-Consolidating Concrete with High-
Tang, M.; Hiinger, K.-J.; and Fournier, B., Jan.-Feb. 2010 .......... 37 Volume Fly Ash (107-M26) May-June 2010 2s
648 ACI Materials Journal/March-April 2011
—Strength-Cementitious Material-Water Relationship for Proportioning
of Fly Ash-Based Concrete (107-M39) July-Aug. 2010 C
Belaid, K. Performance of Cast-in-Place Self-Consolidating Concrete
Made with Various Types of Viscosity-Enhancing Admixtures (107-M47)
Calcium chloride Effect of Calcium Chloride and Initial Curing Temperature
July-Aug. 2010
on Expansion Caused by Sulfate Exposure (107-M72) Kosbab, B. D., and
Bennacer, R. Analysis of Mortar Long-Term Strength with Supplementary
Kurtis, K. E., Nov.-Dec. 2010
Cementitious Materials Cured at Different Temperatures (107-M37) July-Aug.
Calcium hydroxide content Calcium Hydroxide Formation in Thin Cement
ME stot ola nae nana eee Ned oO Mek Wie ease ee de wage Ree 323
Paste Exposed to Air (107-M42) Haselbach, L. M., and Liu, L., July-Aug.
Bentz, D. P.
—Planar Image-Based Reconstruction of Pervious Concrete Pore Structure
Calcium Hydroxide Formation in Thin Cement Paste Exposed to Air
and Permeability Prediction (107-M48) July-Aug. 2010
(107-M42) Haselbach, L. M., and Liu, L., July-Aug. 2010
—Powder Additions to Mitigate Retardation in High-Volume Fly Ash
Carbon Carbon-Fiber Cement-Based Materials for Electromagnetic
Mixtures (107-M58) Sept.-Oct. 2010
Shielding (107-M68) Muthusamy, S., and Chung, D. D. L., Nov.-Dec.
Bermudez, M. A. Models for Chloride Diffusion Coefficients of Concretes
in Tidal Zone (107-MO1) Jan.-Feb. 2010 ...................00000- 3
Carbon fiber Triple Percolation in Concrete Reinforced with Carbon Fiber
Bernard, E. S. Influence of Fiber Type on Creep Deformation of Cracked
(107-M46) Baeza, F. J.; Chung, D. D. L.; Zornoza, E.; Andién, L. G.; and
Fiber-Reinforced Shotcrete Panels (107-M54) Sept.-Oct. 2010
Garcés, P., July-Aug. 2010
Beushausen, H. D. Suitability of Various Measurement Techniques for
Carbon-Fiber Cement-Based Materials for Electromagnetic Shielding
Assessing Corrosion in Cracked Concrete (107-M55) Sept.-Oct.
(107-M68) Muthusamy, S., and Chung, D. D. L., Nov.-Dec. 2010... 602
Carse, A. H. Performance of Permeability-Reducing Admixtures in Marine
Bhattacharjee, B. Effect of Age and Water-Cement Ratio on Size and
Concrete Structures (107-M34) May-June 2010
Dispersion of Pores in Ordinary Portland Cement Paste (107-M19) Mar.-Apr.
Cathodic protection Conductive Concrete for Cathodic Protection of
Bridge Decks (107-M65) Yehia, S., and Host, J., Nov.-Dec. 2010 . . . 577
Bhethanabotla, V. R. Measurement of Oxygen Permeability of Epoxy
Cation exchange capacity Detection of Aggregate Clay Coatings and
Polymers (107-M18) Mar.-Apr. 2010
Impacts on Concrete (107-M45) Mufioz, J. F.; Tejedor, M. I.; Anderson, M. A.;
Bidirectional Multiple Cracking Tests on High-Performance Fiber-
ond Conmmas, 3. BE, PRG, FOOD vas cee ivcnwscademiiennnaa ’ 387
Reinforced Cementitious Composite Plates (107-M51) Suryanto, B.;
Cement asphalt mortar Temperature Stability of Compressive Strength of
Nagai, K.; and Maekawa, K., Sept.-Oct. 2010
Cement Asphalt Mortar (107-M04) Wang, F.; Liu, Z.; Wang, T.; and Hu, S.,
Bilir, T.
Jan.-Feb. 2010
—Effect of Bottom Ash as Fine Aggregate on Shrinkage Cracking of
Cement-based materials Wavelet Analysis of Ultrasonic Pulses in
Mortars (107-M08) Jan.-Feb. 2010
Cement-Based Materials (107-M29) Nogueira, C. L., May-June 2010... 248
—Effect of Non-Ground-Granulated Blast-Furnace Slag as Fine
Aggregate on Shrinkage Cracking of Mortars (107-M61) Nov.-Dec. Cement paste
SR cst 675s 6 sa Minna a pli a wie eR aa naw nw a aloa gk a Oe —Effect of Age and Water-Cement Ratio on Size and Dispersion of Pores
Blunt, J. Electrical Resistance Tomography for Assessment of Cracks in in Ordinary Portland Cement Paste (107-M19) Kondraivendhan, B., and
Concrete (107-M60) Sept.-Oct. 2010 Bhattacharjee, B., Mar.-Apr. 2010
Bonakdar, A. Correlation of Reaction Products and Expansion Potential in —Investigation into Yield Behavior of Fresh Cement Paste: Model and
Alkali-Silica Reaction for Blended Cement Materials (107-M44) July-Aug. Experiment (107-M02) Lu, G., and Wang, K., Jan.-Feb. 2010
ME ane tc £05k SARL ATIC a LEGER Ges CUS a wee Ren te eRe RAG 380 Cetrangolo, G. P. Inspection of Concrete Using Air-Coupled Ultrasonic
Bond Pulse Velocity (107-M20) Mar.-Apr. 2010
—Comparison of Methods for Texture Assessment of Concrete Surfaces Chai, H. K. Characterization of Deep Surface-Opening Cracks in
(107-M49) Santos, P. M. D., and Santos Julio, E. N. B., Sept.-Oct. Concrete: Feasibility of Impact-Generated Rayleigh-Waves (107-M36)
RnPee,s Pee ee E e
—Effect of Filtering on Texture Assessment of Concrete Surfaces (107-M05) Chandra, L. R. Early-Age Shrinkage Strains Versus Depth of Low Water-
Duarte Santos, P. M., and Santos Julio, E. N. B., Jan.-Feb. 2010 ..... 31 Cement Ratio Mortar Prisms (107-M25) May-June 2010
Bond strength Characterization of Deep Surface-Opening Cracks in Concrete: Feasibility
—Interface Tailoring of Polyester-Type Fiber in Engineered Cementitious of Impact-Generated Rayleigh-Waves (107-M36) Chai, H. K.;
Composite Matrix against Pullout (107-M15) Rathod, J. D., and Patodi, S. C., Momoki, S.; Aggelis, D. G.; and Shiotani, T., May-June 2010 .... 305
Mar.-Apr. 2010 Chemical composition Correlation of Reaction Products and Expansion
—Polyvinyl Alcohol Fiber-Reinforced Mortars for Masonry Applications Potential in Alkali-Silica Reaction for Blended Cement Materials
(107-M09) Skourup, B. N., and Erdogmus, E., Jan.-Feb. 2010....... 57 (107-M44) Bonakdar, A.; Mobasher, B.; Dey, S. K.; and Roy, D. M.,
Bottom ash Effect of Bottom Ash as Fine Aggregate on Shrinkage Cracking July-Aug. 2010
of Mortars (107-M08) Topgu, I. B., and Bilir, T., Jan.-Feb. 2010 Chloride Influence of Chemistry of Chloride Ions in Cement Matrix on
Bougara, A. Analysis of Mortar Long-Term Strength with Supplementary Corrosion of Steel (107-M38) Song, H.-W.; Jung, M.-S.; Lee, C.-H.; Kim, S.-H.;
Cementitious Materials Cured at Different Temperatures (107-M37) and Rah, G:F, HR Ss ais oie dk cant icceas oy ieenee eee
July-Aug. 2010 Chloride attack Corrosion Process of Steel Bar in Concrete in Full Lifetime
Bridging oxygens Correlation of Reaction Products and Expansion (107-M63) Yuan, Y.; Jiang, J.; and Peng, T., Nov.-Dec. 2010
Potential in Alkali-Silica Reaction for Blended Cement Materials Chloride-induced corrosion
(107-M44) Bonakdar, A.; Mobasher, B.; Dey, S. K.; and Roy, D. M., —Performance of Permeability-Reducing Admixtures in Marine Concrete
yc akbie re Sede kabigvhsdiscsacntuagn sinsne ’ 380 Structures (107-M34) Dao, V. T. N.; Dux, P. F.; Morris, P. H.; and Carse, A. H..,
Brooks, Z. Instantaneous In-Situ Determination of Water-Cement Ratio of May-June 2010
Fresh Concrete (107-M66) Nov.-Dec. 2010 —Suitability of Various Measurement Techniques for Assessing Corrosion
Brucite Expansion of MgO in Cement Pastes Measured by Different in Cracked Concrete (107-M55) Otieno, M. B.; Alexander, M. G.; and
Methods (107-M12) Nokken, M. R., Jan.-Feb. 2010 Beushausen, H. D., Sept.-Oct. 2010
Buffering Influence of Chemistry of Chloride Ions in Cement Matrix on Chloride ingress
Corrosion of Steel (107-M38) Song, H.-W.; Jung, M.-S.; Lee, C.-H.,; —Models for Chloride Diffusion Coefficients of Concretes in Tidal Zone
Kim, S.-H.; and Ann, K. Y., July-Aug. 2010.................... 332 (107-M01) Bermidez, M. A., and Alaejos, P., Jan.-Feb. 2010
Building technology Powder Additions to Mitigate Retardation in —Time Evolution of Chloride Penetration in Blended Cement Concrete
High-Volume Fly Ash Mixtures (107-M58) Bentz, D. P., Sept.-Oct. (107-M67) Villagran-Zaccardi, Y. A.; Taus, V. L.; and Di Maio, A. A.,
ACI Materials Journal/March-April 2011
Choi, S. C. Conductive concrete Conductive Concrete for Cathodic Protection of
—New Viscoelastic Model for Early-Age Concrete Based on Measured Bridge Decks (107-M65) Yehia, S., and Host, J., Nov.-Dec. 2010 . . . 577
Strains and Stresses (107-M28) May-June 2010. . Conductive Concrete for Cathodic Protection of Bridge Decks (107-M65)
—Thermal Strain and Drying Shrinkage of Concrete Structures in the Field Wee, B.S ee, BSE. BOO sos 5 cic ws csc bcerinssns 577
(107-M57) Sept.-Oct. 2010 ay 7 (sivandeedew esi Correlation of Reaction Products and Expansion Potential in
Chowdhury, S. Alkali-Silica Reaction for Blended Cement Materials (107-M44)
—Measurement of Oxygen Permeability of Epoxy Polymers (107-M18) Bonakdar, A.; Mobasher, B.; Dey, S. K.; and Roy, D. M., July-Aug.
Mar.-Apr. 2010 . A, ErEee eet Pee TTT ee er eee Perey
—New Methodology to Proportion Self Co nsolidating Co ncrete with High- Corrosion
Volume Fly Ash (107-M26) May-June 2010 o« Oae —Conductive Concrete for Cathodic Protection of Bridge Decks (107-M65)
—Strength-Cementitious Material-Water Relationship for Proportioning Yehia, S., and Host, J., Nov.-Dec. 2010
of Fly Ash-Based Concrete (107-M39) July-Aug. 2010 i 340 —Corrosion Protection of Fiber-Reinforced Polymer-Wrapped Reinforced
Chung, D. D. L. Concrete (107-M40) Gadve, S.; Mukherjee, A.; and Malhotra, S. N.,
—Carbon-Fiber Cement-Based Materials for Electromagnetic Shielding July-Aug. 2010 nina oun aaiadhaayt eeeee hminia nieee
(107-M68) Nov.-Dec. 2010 : ; — 602 —AInfluence of Chemistry of Chloride Ions in Cement Matrix on Corrosion
—Triple Percolation in Concrete Reinforced with C asbon Fiber (107-M46) of Steel (107-M38) Song, H.-W.; Jung, M.-S.; Lee, C.-H.; Kim, S.-H.; and
July-Aug. 2010 ...... 396 Ann, K. Y., July-Aug. 2010 .
Chung, W. Y.-M. Cosep Behavior of High- Strength ‘Conceste with —Measurement of Oxygen Permeability of Epoxy Polymers (107-M18)
Polypropylene Fibers at Elevated Temperatures (107-M22) Mar.-Apr. Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Mar.-Apr.
2010 wa 176 2010
Clays Detection of Aggnese Clay Coatings and ‘Impects on Concrete —Modeling Mechanical Behavi ior of Reinforced Concrete due to Corrosion
(107-M45) Muifioz, J. F.; Tejedor, M. 1.; Anderson, M. A.; and Cramer, S. M., of Steel Bar (107-M14) Kim, K. H.; Jang, S. Y.; Jang, B. S.; and Oh, B. H..,
July-Aug. 2010. ata . 387 Mar.-Apr. 2010
Coarse aggregate Detection of Aggvegnte Clay C eatings and leapacts on Corrosion assessment Suitability of Various Measurement Techniques for
Concrete (107-M45) Mufioz, J. F.; Tejedor, M. L.; Anderson, M. A.; and Assessing Corrosion in Cracked Concrete (107-M55) Otieno, M. B.;
Cramer, S. M., July-Aug. 2010... . .. 387 Alexander, M. G.; and Beushausen, H. D., Sept.-Oct. 2010
Coastal environment Performance of Permeability- Reducing Adenine Corrosion Process of Steel Bar in Concrete in Full Lifetime (107-M63)
in Marine Concrete Structures (107-M34) Dao, V. T. N.; Dux, P. F.; Yuan, Y.; Jiang, J.; and Peng, T., Nov.-Dec. 2010................ 562
Morris, P. H.; and Carse, A. H., May-June 2010 ... cnn cawwee Corrosion Protection of Fiber-Reinforced Polymer-Wrapped Reinforced
Coatings Detection of Aggregate Clay Coatings and Impacts on Concrete Concrete (107-M40) Gadve, S.; Mukherjee, A.; and Malhotra, S. N.,
(107-M45) Mufioz, J. F.; Tejedor, M. L.; Anderson, M. A.; and Cramer, S. M., July-Aug. 2010
July-Aug. 2010 . 387 Corrosion rate Corrosion Process of Steel Bar in Concrete in Full
Compacted Sand Concrete in Pavement co nstruction: An Econeusiea! Lifetime (107-M63) Yuan, Y.; Jiang, J.; and Peng, T., Nov.-Dec.
and Environmental Solution (107-M24) El Euch Khay, S.; Neji, J.; and 2010
Loulizi, A., Mar.-Apr. 2010 ae wwe se tas Crack detection Electrical Resistance Tomography for Assessment of
Comparison of Methods for Texture Aaneenmnent of reo ncrete Surfaces Cracks in Concrete (107-M60) Karhunen, K.; Seppianen, A.; Lehikoinen, A.;
(107-M49) Santos, P. M. D., and Santos Julio, E. N. B., Sept.-Oct. Blunt, J.; Kaipio, J. P.; and Monteiro, P. J. M., Sept.-Oct. 2010 ... . . 523
2010 —— 433 Cracked concrete Suitability of Various Measurement Techniques for
Compliance function New Viecosiantic Model for Early-Age Concrete Assessing Corrosion in Cracked Concrete (107-M55) Otieno, M. B.;
Basedo n Measured Strains and Stresses (107-M28) Choi, S. C., and Oh, B. H., Alexander, M. G.; and Beushausen, H. D., Sept.-Oct. 2010
May-June 2010 ; ; "Ce aa Cracking
Compressive strength —Effect of Bottom Ash as Fine Aggregate on Shrinkage Cracking of
—Analysis of Mortar Long-Term Strength with Supplementary Cementitious Mortars (107-M08) Topgu, I. B., and Bilir, T., Jan.-Feb. 2010
Materials Cured at Different Temperatures (107-M37) Ezziane, K.; —Effect of Non-Ground-Granulated Blast-Furnace Slag as Fine Aggregate
Kadri, E.-H.; Bougara, A.; and Bennacer, R., July-Aug. 2010 .. 323 on Shrinkage Cracking of Mortars (107-M61) Topgu, I. B., and Bilir, T.,
—dAssessing Mechanical Properties and Microstructure of Fire-Damaged Nov.-Dec. 2010. ee ee ee
Engineered Cementitious Composites (107-M35) Sahmaran, M.; Lachemi, M.; —Modeling Mechondenl Behavior of Reinforced Concrete due to Corrosion
and Li, V.C., May-June 2010........ , . 297 of Steel Bar (107-M14) Kim, K. H.; Jang, S. Y.; Jang, B. S.; and Oh, B. H.,
—Compacted Sand Concrete in Pavement Constenation: An Economical Mar.-Apr. 2010 .
and Environmental Solution (107-M24) El Euch Khay, S.; Neji, J.; and Cramer, S. M. Detection of Aggregate Clay Coatings and Impacts on
Loulizi, A., Mar.-Apr. 2010 ..... = is 195 Concrete (107-M45) July-Aug. 2010 ................-..+.4++.3.8 7
—Compressive Strength Relationships for Concrete under Elevated Creep
Temperatures (107-M21) Knaack, A. M.; Kurama, Y. C.; and Kirkner, D. J., —Creep Behavior of High-Strength Concrete with Polypropylene Fibers at
Mar.-Apr. 2010... . Serer Elevated Temperatures (107-M22) Wu, B.; Lam, E. S.-S.; Liu, Q.;
—Polyviny! Alcohol Fiber- Reinfoaced Mortars for Mesenty Applications Chung, W. Y.-M.; and Ho, I. F.-Y., Mar.-Apr. 2010
(107-M09) Skourup, B. N., and Erdogmus, E., Jan.-Feb. 2010 —Influence of Fiber Type on Creep Deformation of Cracked Fiber-Reinforced
—Precision of Compressive Strength Testing of Concrete with Different Shotcrete Panels (107-M54) Bernard, E. S., Sept.-Oct. 2010
Cylinder Specimen Sizes (107-M52) Taghaddos, H.; Soleymani, H. R.; Creep Behavior of High-Strength Concrete with Polypropylene Fibers
and Robson, J. D., Sept.-Oct. 2010 — at Elevated Temperatures (107-M22) Wu, B.; Lam, E. S.-S.; Liu, Q.;
—Size and Wall Effects on Compressive Strength of Concretes (107-M43) Chung, W. Y.-M.; and Ho, I. F.-Y., Mar.-Apr. 2010 . 176
Turkel, A., and Ozkul, M. H., July-Aug. 2010 : 372 Critical Corrosion Threshold of Galvanized Reinforcing Bars (106-M22)
—Temperature Stability of Compressive Strength of Cement t Asphalt Mortar —Darwin, D.; Browning, J.; O'Reilly, M.; Xing, L.; and Ji, J., Mar.-Apr.
(107-M04) Wang, F.; Liu, Z.; Wang, T.; and Hu, S., Jan.-Feb. 2010 27
Compressive Strength Relationships for Concrete under Elevated
Temperatures (107-M21) Knaack, A. M.; Kurama, Y. C.; and Kirkner, D. J., Crystalline swelling Detection of Aggregate Clay Coatings and Impacts on
Mar.-Apr. 2010 : “es Terre re. Concrete (107-M45) Mufioz, J. F.; Tejedor, M. 1; Anderson, M. A.; and
Concrete cores Size and Wall Effects on Compressive Strength of eg eeee ee e
Concretes (107-M43) Turkel, A., and Ozkul, M. H., July-Aug. 2010 . . .3 72 Curing
Concrete mixture proportioning Self-Consolidating High-Strength —Effect of Calcium Chloride and Initial Curing Temperature on Expansion
Concrete Optimization by Mixture Design Method (107-M41) Akalin, O.; Caused by Sulfate Exposure (107-M72) Kosbab, B. D., and Kurtis, K. E.,
Akay, K. U.; and Sennaroglu, B., July-Aug. 2010 ................ 357 Nov.-Dec. 2010
650 ACI Materials Journal/March-April 2011
—Effect of Curing Methods on Autogenous Shrinkage and Self-Induced —Modeling Mechanical Behavior of Reinforced Concrete due to Corrosion
Stress of High-Performance Concrete (107-M10) Meddah, M. S., and Sato, R., of Steel Bar (107-M14) Kim, K. H.; Jang, S. Y.; Jang, B. S.; and Oh, B. H.,
Jan.-Feb. 2010 Mar.-Apr. 2010
Cutting damage Size and Wall Effects on Compressive Strength of —Models for Chloride Diffusion Coefficients of Concretes in Tidal Zone
Concretes (107-M43) Turkel, A., and Ozkul, M. H., July-Aug. 2010... 372 (107-MO1) Bermiidez, M. A., and Alaejos, P., Jan.-Feb. 2010 ........ 3
Cylinders Precision of Compressive Strength Testing of Concrete with Different —Performance of Permeability-Reducing Admixtures in Marine Concrete
Cylinder Specimen Sizes (107-M52) Taghaddos, H.; Soleymani, H. R.; Structures (107-M34) Dao, V. T. N.; Dux, P. F.; Morris, P. H.; and
and Robson, J. D., Sept.-Oct. 2010 Carse, A. H., May-June 2010
—Salt Weathering of Concrete by Sodium Carbonate and Sodium Chloride
(107-M30) Haynes, H.; O’ Neill, R.; Neff, M.; and Mehta, P. K., May-June
Damage assessment Numerical Simulation of Stress Waves on Surface of Dux, P. F. Performance of Permeability-Reducing Admixtures in Marine
Strongly Heterogeneous Media (107-M53) Aggelis, D. G., Sept.-Oct. Concrete Structures (107-M34) May-June 2010
Dao, V. T. N. Performance of Permeability-Reducing Admixtures in
Marine Concrete Structures (107-M34) May-June 2010 ........... 291
Deng, M. Eamon, C. D. Ultra-High-Strength, Glass Fiber-Reinforced Concrete:
—lInvestigation of Alkali-Silica Reaction Inhibited by New Lithium Mechanical Behavior and Numerical Modeling (107-M23) Mar.-Apr.
Compound (107-M06) Jan.-Feb. 2010... 2.2.200...0. e.e.e e.a e 37 2010
—Potential Approach to Evaluating Soundness of Concrete Containing Early age Early-Age Shrinkage Strains Versus Depth of Low Water-
MgO-Based Expansive Agent (107-M13) Mar.-Apr. 2010 Cement Ratio Mortar Prisms (107-M25) Ong, K. C. G.; Chandra, L. R.;
Design and Myint-Lay, K., May-June 2010.....................2+.--- 213
—Compressive Strength Relationships for Concrete under Elevated Early-age autogenous shrinkage Effect of Curing Methods on Autogenous
Temperatures (107-M21) Knaack, A. M.; Kurama, Y. C.; and Kirkner, D. J., Shrinkage and Self-Induced Stress of High-Performance Concrete
Mar.-Apr. 2010 (107-M10) Meddah, M. S., and Sato, R., Jan.-Feb. 2010
—Design and Research on Gradient Structure Concrete Based on Volumetric Early-age concrete
Stabilization (107-M69) Wen, X.-D.; Ma, B.-G.; Gan, W.-Z.; and Xian, Z.-W.., —Artificial Neural Network Modeling of Early-Age Dynamic Young's
Nov.-Dec. 2010 Modulus of Normal Concrete (107-M33) Venkiteela, G.; Gregori, A.; Sun, Z.;
Design and Research on Gradient Structure Concrete Based on Volumetric and Shah, S. P., May-June 2010 282
Stabilization (107-M69) Wen, X.-D.; Ma, B.-G.; Gan, W.-Z.; and —New Viscoelastic Model for Early-Age Concrete Based on Measured Strains
Xian, Z.-W., Nov.-Dec. 2010 and Stresses (107-M28) Choi, S. C., and Oh, B. H., May-June 2010.... . 239
Detection ofA ggregate Clay Coatings and Impacts on Concrete (107-M45) Early-Age Shrinkage Strains Versus Depth of Low Water-Cement
Muniz, J. F.; Tejedor, M. I.; Anderson, M. A.; and Cramer, S. M., July-Aug. Ratio Mortar Prisms (107-M25) Ong, K. C. G.; Chandra, L. R.; and
Myint-Lay, K., May-June 2010
Deterioration Salt Weathering of Concrete by Sodium Carbonate and Effect of Age and Water-Cement Ratio on Size and Dispersion of Pores
Sodium Chloride (107-M30) Haynes, H.; O'Neill, R.; Neff, M.; and in Ordinary Portland Cement Paste (107-M19) Kondraivendhan, B.,
Mehta, P. K., May-June 2010 and Bhattacharjee, B., Mar.-Apr. 2010 Mee)
Dey, S. K. Correlation of Reaction Products and Expansion Potential in Effect of Aggregate Size and Gradation on Pervious Concrete Mixtures
Alkali-Silica Reaction for Blended Cement Materials (107-M44) July-Aug. (107-M71) Neptune, A. L., and Putman, B. J., Nov.-Dec. 2010
Effect of Aggregate Type on Mechanical Properties of Reactive Powder
Diffusion Measurement of Oxygen Permeability of Epoxy Polymers Concrete (107-MS50) Aydin, S.; Yazici, H.; Yardimci, M. Y.; and Yigiter, H.,
(107-M18) Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Sept.-Oct. 2010
Mar.-Apr. 2010 Effect of Bottom Ash as Fine Aggregate on Shrinkage Cracking of
Di Maio, A. A. Time Evolution of Chloride Penetration in Blended Cement Mortars (107-M08) Topgu, I. B., and Bilir, T., Jan.-Feb. 2010
Concrete (107-M67) Nov.-Dec. 2010 Effect of Calcium Chloride and Initial Curing Temperature on Expansion
Direct tension test Ultra-High-Strength, Glass Fiber-Reinforced Concrete: Caused by Sulfate Exposure (107-M72) Kosbab, B. D., and Kurtis, K. E.,
Mechanical Behavior and Numerical Modeling (107-M23) Roth, M. J.; Nov.-Dec. 2010
Eamon, C. D.; Slawson, T. R.; Tonyan, T. D.; and Dubey, A., Mar.-Apr. Effect of Curing Methods on Autogenous Shrinkage and Self-Induced
Stress of High-Performance Concrete (107-M10) Meddah, M. S., and
Dispersion Effect of Age and Water-Cement Ratio on Size and Dispersion Sato, R., Jan.-Feb. 2010
of Pores in Ordinary Portland Cement Paste (107-M19) Kondraivendhan, B.., Effect of Different Dosages of Polypropylene Fibers in Thin Whitetopping
and Bhattacharjee, B., Mar.-Apr. 2010 Concrete Pavements (107-M07) Rodezno, M. C., and Kaloush, K. E.,
Drilling damage Size and Wall Effects on Compressive Strength of Jan.-Feb. 2010
Concretes (107-M43) Turkel, A., and Ozkul, M. H., July-Aug. 2010... 372 Effect of Filtering on Texture Assessment of Concrete Surfaces (107-M05)
Drying shrinkage Duarte Santos, P. M., and Santos Julio, E. N. B., Jan.-Feb. 2010 ..... 31
—Shrinkage of Precast, Prestressed Self-Consolidating Concrete (107-M27) Effect of Mixture Compositions on Workability and Strength of Fly
Khayat, K. H., and Long, W. J., May-June 2010 Ash-Based Inorganic Polymer Mortar (107-M62) Wu, H.-C., and Sun, P.,
—Thermal Strain and Drying Shrinkage of Concrete Structures in the Field Nov.-Dec. 2010
(107-M57) Choi, S., and Won, M. C., Sept.-Oct. 2010 Effect of Non-Ground-Granulated Blast-Furnace Slag as Fine Aggregate
Duarte Santos, P. M. Effect of Filtering on Texture Assessment of on Shrinkage Cracking of Mortars (107-M61) Topcu, I. B., and Bilir, T.,
Concrete Surfaces (107-M05) Jan.-Feb. 2010 ... 2... ......0.00055 31 Nov.-Dec. 2010
Dubey, A. Ultra-High-Strength, Glass Fiber-Reinforced Concrete: Effects of Hauling Time on Air-Entrained Self-Consolidating Concrete
Mechanical Behavior and Numerical Modeling (107-M23) Mar.-Apr. (107-M32) Ghafoori, N., and Barfield, M., May-June 2010
2010 re 185 Effeocf tLiqsui d Nitrogen Cooling on Fresh Concrete Properties (107-M16)
Ductility Experimental Study on Mechanical Properties of Concrete Juenger, M. C. G.; Solt, S. M.; and Hema, J., Mar.-Apr. 2010 123
Confined with Plastic Pipe (107-M17) Wang, J., and Yang, Q., Mar.-Apr. Efficiency factors Models for Chloride Diffusion Coefficients of Concretes
2010 in Tidal Zone (107-M01) Bermiidez, M. A., and Alaejos, P., Jan.-Feb.
Durability BD ciicncdine® ixdieckbek supe dns heen aednee ae 3
—Instantaneous In-Situ Determination of Water-Cement Ratio of Fresh Electrical conductivity Triple Percolation in Concrete Reinforced with
Concrete (107-M66) Mancio, M.; Moore, J. R.; Brooks, Z.; Monteiro, P. J. M.; Carbon Fiber (107-M46) Baeza, F. J.; Chung, D. D. L.; Zornoza, E.;
me Genet, B. 0, ROO IOR FIs oc ick bins sv edveciavendands 586 Andion, L. G.; and Garcés, P., July-Aug. 2010
ACI Materials Journal/March-April 2011
Electrical resistance tomography Electrical Resistance Tomography for Fiber-reinforced mortar Polyviny! Alcohol Fiber-Reinforced Mortars for
Assessment of Cracks in Concrete (107-M60) Karhunen, K.; Seppanen, A.; Masonry Applications (107-M09) Skourup, B. N., and Erdogmus, E.,
Lehikoinen, A.; Blunt, J.; Kaipio, J. P.; and Monteiro, P. J. M., Sept.-Oct. Re Pe ory ee ee ne Pee ete re Eee 57
2010. Fiber-reinforced polymer
Electrical Resistance Tomography for Assessment of Cracks in —Corrosion Protection of Fiber-Reinforced Polymer-Wrapped Reinforced
Concrete (107-M60) Karhunen, K.; Seppiinen, A.; Lehikoinen, A.; Blunt, J.; Concrete (107-M40) Gadve, S.; Mukherjee, A.; and Malhotra, S..N.,
Kaipio, J. P.; and Monteiro, P. J. M., Sept.-Oct. 2010 ............. 523 I DUE ia tb es Uhl ce <sn ca canoer Seeimksicek nema ee 349
Electrical resistivity —Environmental Effects on Mechanical Properties of Wet Lay-Up Fiber-
—Carbon-Fiber Cement-Based Materials for Electromagnetic Shielding Reinforced Polymer (107-M31) Saadatmanesh, H.; Tavakkolizadeh, M.;
(107-M68) Muthusamy, S., and Chung, D. D. L., Nov.-Dec. 2010 . . . 602 and Mostofinejad, D., May-June 2010 ...............--2.0eeeee 267
—Instantaneous In-Situ Determination of Water-Cement Ratio of Fresh Field implementation Thermal Strain and Drying Shrinkage of Concrete
Concrete (107-M66) Mancio, M.; Moore, J. R.; Brooks, Z.; Monteiro, P. J. M.; Structures in the Field (107-M57) Choi, S., and Won, M. C., Sept.-Oct.
and Glaser, S. D., Nov.-Dec. 2010 .. 586
—Triple Percolation in Concrete Reinforced with cw hen Fiber (107-M46) Filter Effect of Filtering on Texture Assessment of Concrete Surfaces
Baeza, F. J.; Chung, D. D. L.; Zornoza, E.; Andién, L. G.; and Garcés, P., (107-M05) Duarte Santos, P. M., and Santos Julio, E. N. B., Jan.-Feb.
July-Aug. 2010. Sees
Electromagnetic shielding Carbon-Fiber Comes Based Materials for
Electromagnetic Shielding (107-M68) Muthusamy, S., and Chung, D. D. L., —Effect of Bottom Ash as Fine Aggregate on Shrinkage Cracking of
Nov.-Dec. 2010... .. . 602 Mortars (107-M08) Topcu, I. B., and Bilir, T., Jan.-Feb. 2010
El Euch Khay, S. Compacted Sand Conceete ii n Povement Construction: An —Effect of Non-Ground-Granulated Blast-Furnace Slag as Fine Aggregate
Economical and Environmental Solution (107-M24) Mar.-Apr. 2010 . . . 195 on Shrinkage Cracking of Mortars (107-M61) Topgu, I. B., and Bilir, T.,
El-Tawil, S. Hybrid Rotating/Fixed-Crack Model for High-Performance Fiber- UII SII Bao oa birds Gis eux oo amare dt nok eee ala ta 545
Reinforced Cementitious Composites (107-M64) Nov.-Dec. 2010 .... . . 568 Finite element analysis Ultra-High-Strength, Glass Fiber-Reinforced
Energy absorption Polyvinyl Alcohol Fiber-Reinforced Mortars for Concrete: Mechanical Behavior and Numerical Modeling (107-M23)
Masonry Applications (107-M09) Skourup, B. N., and Erdogmus, E., Roth, M. J.; Eamon, C. D.; Slawson, T. R.; Tonyan, T. D.; and Dubey, A
Jan.-Feb. 2010 ss ee Mar.-Apr. 2010
Engineered cementitious composites Fire resistance Assessing Mechanical Properties and Microstructure of
—Assessing Mechanical Properties and Microstructure of Fire-Damaged Fire-Damaged Engineered Cementitious Composites (107-M35)
Engineered Cementitious Composites (107-M35) Sahmaran, M.; Lachemi, M.; Sahmaran, M.; Lachemi, M.; and Li, V. C., May-June 2010 ........ 297
and Li, V. C., May-June 2010 . 297 Fixed-crack approach Hybrid Rotating/Fixed-Crack Model for High-
—Self-Healing Characterization of Bagineesed Cementitious Composite Performance Fiber-Reinforced Cementitious Composites (107-M64)
Materials (107-M70) Kan, L.-L.; Shi, H.-S.; Sakulich, A. R.; and Li, V. C., Hung, C.-C., and El-Tawil, S., Nov.-Dec. 2010
Nov.-Dec. 2010 eye Flexural strength Compacted Sand Concrete in Pavement Construction:
Environmental effects Environmental Effects on Mec henical Peapestion of An Economical and Environmental Solution (107-M24) El Euch Khay, S.;
Wet Lay-Up Fiber-Reinforced Polymer (107-M31) Saadatmanesh, H.; Neji, J.; and Loulizi, A., Mar.-Apr. 2010
Tavakkolizadeh, M.; and Mostofinejad, D., May-June 2010 ........ 267 Flexural test Ultra-High-Strength, Glass Fiber-Reinforced Concrete:
Environmental Effects on Mechanical Properties of Wet Lay-Up Fiber- Mechanical Behavior and Numerical Modeling (107-M23) Roth, M. J.;
Reinforced Polymer (107-M31) Saadatmanesh, H.; Tavakkolizadeh, M.; Eamon, C. D.; Slawson, T. R.; Tonyan, T. D.; and Dubey, A., Mar.-Apr.
and Mostofinejad, D., May-June 2010. 2010
Epoxy Measurement of Oxygen Permeability of Epoxy Poly:m ers (107-M18) Flexure Polyvinyl Alcohol Fiber-Reinforced Mortars for Masonry
Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Mar.-Apr Applications (107-M09) Skourup, B. N., and Erdogmus, E., Jan.-Feb.
2010 i ee 2010.
Erdogmus, E. Polyviny! Alcohol Fiber- Reinforced Mortars for Masonry Flexure strength Corrosion Protection of Fiber-Reinforced Polymer-
Applications (107-M09) Jan.-Feb. 2010... <aveca Wrapped Reinforced Concrete (107-M40) Gadve, S.; Mukherjee, A.; and
Expansion of MgO in Cement Pastes Measured by Different Methods Pe: i ee NE: SOs oso sva cdcckwssacemaatdanenee 349
(107-M12) Fly ash
—Nokken, M. R., Jan.-Feb. 2010 : Parmnine acto aaae —Correlation of Reaction Products and Expansion Potential in Alkali-
—Disc. by Wang, H., and Qi, C., Nov.-Dec. 2010. . . iia 640 Silica Reaction for Blended Cement Materials (107-M44) Bonakdar, A.;
Expansion pressure Modeling Mechanical Behavior of Reinfesc ed Mobasher, B.; Dey, S. K.; and Roy, D. M., July-Aug. 2010 ........ 380
Concrete due to Corrosion of Steel Bar (107-M14) Kim, K. H.; Jang, S. Y.; —Effect of Mixture Compositions on Workability and Strength of Fly Ash-
Jang, B. S.; and Oh, B. H., Mar.-Apr. 2010 eee . 106 Based Inorganic Polymer Mortar (107-M62) Wu, H.-C., and Sun, P.,
Experimental Study on Mechanical Properties of Concrete Confined with Nov.-Dec. 2010
PlasPitpei (c10 7-M17) WangJ.,, a nd Yang, Q., Mar.-Apr. 2010... .... 132 —Synergistic Effect between Glass Frit and Blast-Furnace Slag (107-M11)
Ezziane, K. Analysis of Mortar Long-Term Strength with Supplementary Laldji, S.; Phithaksounthone, A.; and Tagnit-Hamou, A., Jan.-Feb.
Cementitious Materials Cured at Different Temperatures (107-M37) 2010
July-Aug. 2010 ... ne ae en 323 Fly ash-based concrete Strength-Cementitious Material-Water Relationship
for Proportioning of Fly Ash-Based Concrete (107-M39) Chowdhury, S.,
F
and Basu, P. C., July-Aug. 2010
Formwork pressure Intrinsic Model to Predict Formwork Pressure
Fabric Environmental Effects on Mechanical Properties of Wet Lay-Up (107-M03) Kwon, S. H.; Shah, S. P.; Phung, Q. T.; Kim, J. H.; and Lee, Y.,
Fiber-Reinforced Polymer (107-M31) Saadatmanesh, H.; Tavakkolizadeh, M.; Jan.-Feb. 2010
and Mostofinejad, D., May-June 2010 . Fournier, B. Investigation of Alkali-Silica Reaction Inhibited by New
Fatigue Compacted Sand Concrete in Pavement Construction: ae Economical Lithium Compound (107-M06) Jan.-Feb. 2010 ...................37
and Environmental Solution (107-M24) El Euch Khay, S.; Neji, J.; and Fracture energy Effect of Aggregate Type on Mechanical Properties of
Loulizi, A., Mar.-Apr. 2010. aera: Reactive Powder Concrete (107-MS50) Aydin, S.; Yazici, H.; Yardimci, M. Y.;
Fiber Carbon-Fiber Coment- Based Materials fn Electromagnetic and Yigiter, H., Sept.-Oct. 2010
Shielding (107-M68) Muthusamy, S., and Chung, D. D. L., Nov.-Dec. Frequency analysis Wavelet Analysis of Ultrasonic Pulses in Cement-
a ne inoue wee Based Materials (107-M29) Nogueira, C. L., May-June 2010....... 248
Fiber-reinforced cc oncrete Influence of Fiber Type on Crre ep Deformation Fresh concrete Instantaneous In-Situ Determination of Water-Cement
of Cracked Fiber-Reinforced Shotcrete Panels (107-M54) Bernard, E. S., Ratio of Fresh Concrete (107-M66) Mancio, M.; Moore, J. R.; Brooks, Z.;
Sept.-Oct. 2010 Monteiro, P. J. M.; and Glaser, S. D., Nov.-Dec. 2010 ............. 586
652 ACI Materials Journal/March-April 2011
Ho, I. F.-Y. Creep Behavior of High-Strength Concrete with Polypropylene
G Fibers at Elevated Temperatures (107-M22) Mar.-Apr. 2010
Host, J. Conductive Concrete for Cathodic Protection of Bridge Decks
Gadve, S. Corrosion Protection of Fiber-Reinforced Polymer-Wrapped (107-M65) Nov.-Dec. 2010
Reinforced Concrete (107-M40) July-Aug. 2010................. 349 Hot weather concreting Effects of Liquid Nitrogen Cooling on Fresh
Gan, W.-Z. Design and Research on Gradient Structure Concrete Based on Concrete Properties (107-M16) Juenger, M. C. G.; Solt, S. M.; and Hema, J.,
Volumetric Stabilization (107-M69) Nov.-Dec. 2010 Mar.-Apr. 2010
Garcés, P. Triple Percolation in Concrete Reinforced with Carbon Fiber Hu, S. Temperature Stability of Compressive Strength of Cement Asphalt
ne isnie nthe curses teens Dhamma pees ate 396 Mortar (107-M04) Jan.-Feb. 2010 .. 2.2.0ce.e 2ce.ce. ee.e e es 27
Geopolymer Effect of Mixture Compositions on Workability and Strength Hung, C.-C. Hybrid Rotating/Fixed-Crack Model for High-Performance
of Fly Ash-Based Inorganic Polymer Mortar (107-M62) Wu, H.-C., and Fiber-Reinforced Cementitious Composites (107-M64) Nov.-Dec.
Sun, P., Nov.-Dec. 2010
Ghafoori, N. Effects of Hauling Time on Air-Entrained Self-Consolidating Hiinger, K.-J. Investigation of Alkali-Silica Reaction Inhibited by New
Concrete (107-M32) May-June 2010 Lithium Compound (107-M06) Jan.-Feb. 2010
Glaser, S. D. Instantaneous In-Situ Determination of Water-Cement Ratio Hwang, S.-D. Performance of Cast-in-Place Self-Consolidating Concrete
of Fresh Concrete (107-M66) Nov.-Dec. 2010 Made with Various Types of Viscosity-Enhancing Admixtures (107-M47)
Glass fiber-reinforced concrete Ultra-High-Strength, Glass Fiber-Reinforced July-Aug. 2010
Concrete: Mechanical Behavior and Numerical Modeling (107-M23) Hybrid Rotating/Fixed-Crack Model for High-Performance Fiber-
Roth, M. J.; Eamon, C. D.; Slawson, T. R.; Tonyan, T. D.; and Dubey, A., Reinforced Cementitious Composites (107-M64) Hung, C.-C., and
Mar.-Apr. 2010 a ig SO, I SSW hs echGiics etree cansceginen 568
Glass frit Synergistic Effect between Glass Frit and Blast-Furnace Slag Hydration
(107-M11) Laldji, S.; Phithaksounthone, A.; and Tagnit-Hamou, A., —Powder Additions to Mitigate Retardation in High-Volume Fly Ash
Jan.-Feb. 2010 Mixtures (107-M58) Bentz, D. P., Sept.-Oct. 2010 ............... 508
Gradient Design and Research on Gradient Structure Concrete Based on —Strength-Cementitious Material-Water Relationship for Proportioning
Volumetric Stabilization (107-M69) Wen, X.-D.; Ma, B.-G.; Gan, W.-Z.; of Fly Ash-Based Concrete (107-M39) Chowdhury, S., and Basu, P. C.,
and Xian, Z.-W., Nov.-Dec. 2010 July-Aug. 2010
Grain-size distribution Waveiet Analysis of Ultrasonic Pulses in Cement-
Based Materials (107-M29) Nogueira, C. L., May-June 2010....... 248
Gregori, A. Artificial Neural Network Modeling of Early-Age Dynamic
Young’s Modulus of Normal Concrete (107-M33) May-June 2010... . 282 Image analysis Early-Age Shrinkage Strains Versus Depth of Low Water-
Ground-granulated blast-furnace slag Effect of Non-Ground-Granulated Cement Ratio Mortar Prisms (107-M25) Ong, K. C. G.; Chandra, L. R.;
Blast-Furnace Slag as Fine Aggregate on Shrinkage Cracking of Mortars and Myint-Lay, K., May-June 2010
(107-M61) Topgu, I. B., and Bilir, T., Nov.-Dec. 2010............ 545 Imaging
—Electrical Resistance Tomography for Assessment of Cracks in Concrete
H (107-M60) Karhunen, K.; Seppinen, A.; Lehikoinen, A.; Blunt, J.;
Kaipio, J. P.; and Monteiro, P. J. M., Sept.-Oct. 2010
Hardened state properties New Methodology to Proportion Self- —Inspection of Concrete Using Air-Coupled Ultrasonic Pulse Velocity
Consolidating Concrete with High-Volume Fly Ash (107-M26) Chowdhury, S., (107-M20) Cetrangolo, G. P., and Popovics, J. S., Mar.-Apr. 2010... . 155
and Basu, P. C., May-June 2010 Impressed current Conductive Concrete for Cathodic Protection of Bridge
Haselbach, L. M. Calcium Hydroxide Formation in Thin Cement Paste Decks (107-M65) Yehia, S., and Host, J., Nov.-Dec. 2010
Exposed to Air (107-M42) July-Aug. 2010...................... 365 Inclined plane Inclined Plane Test to Evaluate Structural Buildup at Rest
Hauling time Effects of Hauling Time on Air-Entrained Self-Consolidating of Self-Consolidating Concrete (107-M59) Khayat, K. H.; Omran, A. F.;
Concrete (107-M32) Ghafoori, N., and Barfield, M., May-June 2010 . . . 275 onl Pavate, F. V., DURA. BIO 5 ov vicciicccavevecdexsaenvar 515
Haynes, H. Salt Weathering of Concrete by Sodium Carbonate and Sodium Inclined Plane Test to Evaluate Structural Buildup at Rest of Self-
Chloride (107-M30) May-June 2010 Consolidating Concrete (107-M59) Khayat, K. H.; Omran, A. F.; and
Hema, J. Effects of Liquid Nitrogen Cooling on Fresh Concrete Properties Pavate, T. V., Sept.-Oct. 2010
(107-M16) Mar.-Apr. 2010 Index Precision of Compressive Strength Testing of Concrete with Different
High-density polyethylene pipe Experimental Study on Mechanical Cylinder Specimen Sizes (107-M52) Taghaddos, H.; Soleymani, H. R.; and
Properties of Concrete Confined with Plastic Pipe (107-M17) Wang, J., Robson, J. D., Sept.-Oct. 2010
and Yang, Q., Mar.-Apr. 2010 Influence of Chemistry of Chloride Ions in Cement Matrix on Corrosion
High-performance concrete Creep Behavior of High-Strength Concrete of Steel (107-M38) Song, H.-W.; Jung, M.-S.; Lee, C.-H.; Kim, S.-H.; and
with Polypropylene Fibers at Elevated Temperatures (107-M22) Wu, B.; Ann, K. Y., July-Aug. 2010
Lam, E. S.-S.; Liu, Q.; Chung, W. Y.-M.; and Ho, I. F.-Y., Mar.-Apr. Influence of Fiber Type on Creep Deformation of Cracked Fiber-
Reinforced Shotcrete Panels (107-M54) Bernard, E. S., Sept.-Oct.
High-performance fiber-reinforced cementitious composites Hybrid
Rotating/Fixed-Crack Model for High-Performance Fiber-Reinforced Influence of Mixing Sequence on Cement-Admixture Interaction
Cementitious Composites (107-M64) Hung, C.-C., and El-Tawil, S., (106-MS55)
DM ME ces tccuhttack tek icede icadaaprnwhiamees nen 568 —Chen, C.-T., and Struble, L. J., Nov.-Dec. 2009
High-range water-reducing admixture Performance of Cast-in-Place —Disc. by Venkatachalapathy, V., Sept.-Oct. 2010
Self-Consolidating Concrete Made with Various Types of Viscosity- Initial damage Bidirectional Multiple Cracking Tests on High-Performance
Enhancing Admixtures (107-M47) Khayat, K. H.; Hwang, S.-D.; and Fiber-Reinforced Cementitious Composite Plates (107-M51) Suryanto, B.;
Belaid, K., July-Aug. 2010 Nagai, K.; and Maekawa, K., Sept.-Oct. 2010
High-strength concrete Inorganic polymer Effect of Mixture Compositions on Workability and
—Self-Consolidating High-Strength Concrete Optimization by Mixture Strength of Fly Ash-Based Inorganic Polymer Mortar (107-M62) Wu, H.-C.,
Design Method (107-M41) Akalin, O.; Akay, K. U.; and Sennaroglu, B., and Sun, P., Nov.-Dec. 2010
July-Aug. 2010 Inspection of Concrete Using Air-Coupled Ultrasonic Pulse Velocity
—Size and Wall Effects on Compressive Strength of Concretes (107-M43) (107-M20) Cetrangolo, G. P., and Popovics, J. S., Mar.-Apr. 2010 .... 155
Turkel, A., and Ozkul, M. H., July-Aug. 2010................... 372 Instantaneous In-Situ Determination of Water-Cement Ratio of Fresh
High-volume fly ash Powder Additions to Mitigate Retardation in High- Concrete (107-M66) Mancio, M.; Moore, J. R.; Brooks, Z.; Monteiro, P. J. M.;
Volume Fly Ash Mixtures (107-M58) Bentz, D. P., Sept.-Oct. 2010 . . . 508 and Glaser, S. D., Nov.-Dec. 2010
ACI Materials Journal/March-April 2011 653
Interface Kirkner, D. J. Compressive Strength Relationships for Concrete under
—Comparison of Methods for Texture Assessment of Concrete Surfaces Elevated Temperatures (107-M21) Mar.-Apr. 2010
(107-M49) Santos, P. M. D., and Santos Julio, E. N. B., Sept.-Oct. Knaack, A. M. Compressive Strength Relationships for Concrete under
Elevated Temperatures (107-M21) Mar.-Apr. 2010
—Effect of Filtering on Texture Assessment of Concrete Surfaces (107-M05) Kondraivendhan, B. Effect of Age and Water-Cement Ratio on Size and
Duarte Santos, P. M., and Santos Julio, E. N. B., Jan.-Feb. 2010...... 31 Dispersion of Pores in Ordinary Portland Cement Paste (107-M19)
Interface Tailoring of Polyester-Type Fiber in Engineered Cementitious Mar.-Apr. 2010
CompoMastriix tagaeins t Pullout (107-M15) Rathod,J .D ., and Patodi, S. C., Kosbab, B. D. Effect of Calcium Chloride and Initial Curing Temperature
Mar.-Apr. 2010 ane ee ee on Expansion Caused by Sulfate Exposure (107-M72) Nov.-Dec.
Interfacial transition zone Corrosion Foscenn of Steel Bar in Concrete in
Full Lifetime (107-M63) Yuan, Y.; Jiang, J.; and Peng, T., Nov.-Dec. Kurama, Y. C. Compressive Strength Relationships for Concrete under
2010. ” Elevated Temperatures (107-M21) Mar.-Apr. 2010
Intrinsic model Intrinsic Model to Predict Penneed: Pressure (107- M03) Kurtis, K. E. Effect of Calcium Chloride and Initial Curing Temperature on
Kwon, S. H.; Shah, S. P.; Phung, Q. T.; Kim, J. H.; and Lee, Y., Jan.-Feb. Expansion Caused by Sulfate Exposure (107-M72) Nov.-Dec. 2010 . . . 632
iA Ms BE es ah a ciara oS athe ig ee ae ald Sea 20 Kwon, S. H. Intrinsic Model to Predict Formwork Pressure (107-M03)
Intrinsic Model to Predict Formwork Prenure ( 107-M 03) Kwon, S. H.; Jan.-Feb. 2010
Shah, S. P.; Phung, Q. T.; Kim, J. H.; and Lee, Y., Jan.-Feb. 2010... . 20
Investigation into Yield Behavior of Fresh Cement Paste: Model and L
Experiment (107-M02) Lu, G., and Wang, K., Jan.-Feb. 2010....... 12
Investigation of Alkali-Silica Reaction Inhibited by New Lithium
Lachemi, M. Assessing Mechanical Properties and Microstructure of Fire-
Compound (107-M06) Mo, X.; Zhang, Y.; Yu, C.; Deng, M.; Tang, M.;
Damaged Engineered Cementitious Composites (107-M35) May-June
Hiinger, K.-J.; and Fournier, B., Jan.-Feb. 2010......... 37
2010
Isothermal calorimetry Powder Additions to Mitigate Retandation ii n High-
Laldji, S. Synergistic Effect between Glass Frit and Blast-Furnace Slag
Volume Fly Ash Mixtures (107-M58) Bentz, D. P., Sept.-Oct. 2010... .5 08
(107-M11) Jan.-Feb. 2010
Lam, E. S.-S. Creep Behavioro f High-Strength Concrete with Poly peapylene
J Fibers at Elevated Temperatures (107-M22) Mar.-Apr. 2010
Laser scanning Comparison of Methods for Texture Assessment of
Jang, B. S. Modeling Mechanical Behavior of Reinforced Concrete due to Concrete Surfaces (107-M49) Santos, P. M. D., and Santos Julio, E. N. B.,
Corrosion of Steel Bar (107-M14) Mar.-Apr. 2010 ... 106 Sept.-Oct. 2010
Jang, S. Y. Modeling Mechanical Behavior of Reinforced Concrete due to Lee, C.-H. Influence of Chemistry of Chloride Ions in Cement Matrix on
Corrosion of Steel Bar (107-M14) Mar.-Apr. 2010 .......... .. 106 Corrosion of Steel (107-M38) July-Aug. 2010
Jiang, J. Corrosion Process of Steel Bar in Concrete in Full Lifetime Lee, Y. Intrinsic Model to Predict Formwork Pressure (107-M03) Jan.-Feb.
(107-M63) Nov.-Dec. 2010. . “ee . 562 2010
Juenger, M. C. G. Effects of Li quid Nitrogen Cooling on Fresh Concrete Lehikoinen, A. Electrical Resistance Tomography for Assessment of
Properties (107-M16) Mar.-Apr. 2010 . . ee Cracks in Concrete (107-M60) Sept.-Oct. 2010. .................
Jung, M.-S. Influence of Chemistry of Chloride lons in Cement Matrix on Li, V. C.
Corrosion of Steel (107-M38) July-Aug. 2010 , +s —Assessing Mechanical Properties and Microstructure of Fire-Damaged
Engineered Cementitious Composites (107-M35) May-June 2010 . . . 297
K —Self-Healing Characterization of Engineered Cementitious Composite
Materials (107-M70) Nov.-Dec. 2010
Kadri, E.-H. Analysis of Mortar Long-Term Strength with Supplementary Limestone Analysis of Mor ‘r Long-Term Strength with Supplementary
Cementitious Materials Cured at Different Temperatures (107-M37) Cementitious Materials Cured at Different Temperatures (107-M37)
July-Aug. 2010 ....... case 323 Ezziane, K.; Kadri, E.-H.; Bougara, A.; and Bennacer, R., July-Aug.
Kaipio, J. P. Electrical Resistance Tomography for Asen ssment of Cracks 2010....
in Concrete (107-M60) Sept.-Oct. 2010 523 Limestone filler Time Evolution of Chloride Penetration in Blended
Kaloush, K. E. Effect of Different Dosages of Polypropylene Fibers in Thin Cement Concrete (107-M67) Villagran-Zaccardi, Y. A.; Taus, V. L.; and
Whitetopping Concrete Pavements (107-M07) Jan.-Feb. 2010 . 42 Di Maio, A. A., Nov.-Dec. 2010. 59:
Kan, L.-L. Self-Healing Characterization of Engineered Cementitious Limewater Expansion of MgO in Cement Pastes Measured by Differeut
Composite Materials (107-M70) Nov.-Dec. 2010 sera tals aa Methods (107-M12) Nokken, M. R., Jan.-Feb. 2010
Karhunen, K. Electrical Resistance Tomography for Assessment of Cracks Lithium compounds Investigation of Alkali-Silica Reaction Inhibited by
in Concrete (107-M60) Sept.-Oct. 2010 A ee New Lithium Compound (107-M06) Mo, X.; Zhang, Y.; Yu, C.; Deng, M.;
Khayat, K. H. Tang, M.; Hiinger, K.-J.; and Fournier, B., Jan.-Feb. 2010
—Inclined Plane Test to Evaluate Structural Buildup at Rest of Self- Liu, L. Calcium Hydroxide Formation in Thin Cement Paste Exposed to Air
Consolidating Concrete (107-M59) Sept.-Oct. 2010 .. sae (107-M42) July-Aug. 2010 .
—Performance of Cast-in-Place Self-Consolidating Concrete Made with Liu, Q. Creep Behavior of High-Strength Concrete with Polypropy.ene
Various Types of Viscosity-Enhancing Admixtures (107-M47) July-Aug. Fibers at Elevated Temperatures (107-M22) Mar.-Apr. 2010
2010 403 Liu, Z. Temperature Stability of Compressive Strength of Cement Asphalt
—Shrinkage of Precast, Prestnsed Self-Consolidating Concrete (107-M27) Mortar (107-M04) Jan.-Feb. 2010. .
May-June 2010 .... ; 231 Long, W. J. Shrinkage of Precast, Prestressed Self-Consolidating
Kheder, G. F. New Method for Proportioning Self.( consolidating Concrete Concrete (107-M27) May-June 2010
Based on Compressive Strength Requirements (107-M56) Sept.-Oct. Longitudinal wave Numerical Simulation of Stress Waves on Surface of
2010. ary .. 490 Strongly Heterogeneous Media (107-M53) Aggelis, D. G., Sept.-Oct.
Khoe, C. Messusement of Oxygen Permeability ” Reeny Poly mers 2010
(107-M18) Mar.-Apr. 2010....... ae . 138 Long-term durability Ravissumentel Effects on Mechanical Properties of
Kim, J. H. Intrinsic Model to Predict Formwork Pressure (107-M03) Wet Lay-Up Fiber-Reinforced Polymer (107-M31) Saadatmanesh, H.:
Jan.-Feb. 2010. ala See Tavakkolizadeh, M.; and Mostofinejad, D., May-June 2010 ........ 267
Kim, K. H. Modeling Mechanical Behavior of f Reinforced Co ncrete due to Loulizi, A. Compacted Sand Concrete in Pavement Construction: An
Corrosion of Steel Bar (107-M14) Mar.-Apr. 2010 . Economical and Environmental Solution (107-M24) Mar.-Apr. 2010 . . . 195
Kim, S.-H. Influence of Chemistry of Chloride lons in Cement Matrix on Lu, G. Investigation into Yield Behavior of Fresh Cement Paste: Model and
Corrosion of Steel (107-M38) July-Aug. 2010. Experiment (107-M02) Jan.-Feb. 2010
654 ACI Materials Journal/March-April 2011
Mo, L. Potential Approach to Evaluating Soundness of Concrete Containing
MgO-Based Expansive Agent (107-M13) Mar.-Apr. 2010
Mo, X. Investigation of Alkali-Silica Reaction Inhibited by New Lithium
Ma, B.-G. Design and Research on Gradient Structure Concrete Based on Compound (107-M06) Jan.-Feb. 2010
Volumetric Stabilization (107-M69) Nov.-Dec. 2010 Mobasher, B. Correlation of Reaction Products and Expansion Potential
Macrosynthetic fibers Influence of Fiber Type on Creep Deformation of in Alkali-Silica Reaction for Blended Cement Materials (107-M44)
July-Aug. 2010
Cracked Fiber-Reinforced Shotcrete Panels (107-M54) Bernard, E. S.,
Sept.-Oct. 2010 Modeling Measurement of Oxygen Permeability of Epoxy Polymers
Maekawa, K. Bidirectional Multiple Cracking Tests on High-Performance (107-M18) Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R.,
Mar.-Apr. 2010
Fiber-Reinforced Cementitious Composite Plates (107-M51) Sept.-Oct.
Modeling Mechanical Behavior of Reinforced Concrete due to
Malhotra, S. N. Corrosion Protection of Fiber-Reinforced Polymer- Corrosion of Steel Bar (107-M14) Kim, K. H.; Jang, S. Y.; Jang, B. S.;
Wrapped Reinforced Concrete (107-M40) July-Aug. 2010 and Oh, B. H., Mar.-Apr. 2010
Mancio, M. Instantaneous In-Situ Determination of Water-Cement Ratio of Models for Chloride Diffusion Coefficients of Concretes in Tidal Zone
Fresh Concrete (107-M66) Nov.-Dec. 2010 (107-M01) Bermidez, M. A., and Alaejos, P., Jan.-Feb. 2010
Modulus of elasticity Artificial Neural Network Modeling of Early-Age
Marine environment Models for Chloride Diffusion Coefficients of
Dynamic Young’s Modulus of Normal Concrete (107-M33) Venkiteela, G.;
Concretes in Tidal Zone (107-M01) Bermiidez, M. A., and Alaejos, P.,
NG A iret Sie ate wiser bce wid rn Rowena dcan le Kaen cet eeatar e 3 Gregori, A.; Sun, Z.; and Shah, S. P., May-June 2010
Moisture loss Early-Age Shrinkage Strains Versus Depth of Low Water-
Masonry structures Polyvinyl Alcohol Fiber-Reinforced Mortars for
Masonry Applications (107-M09) Skourup, B. N., and Erdogmus, E., Cement Ratio Mortar Prisms (107-M25) Ong, K. C. G.; Chandra, L. R.;
and Myint-Lay, K., May-June 2010
Jan.-Feb. 2010
Momoki, S. Characterization of Deep Surface-Opening Cracks in
Mass loss Corrosion Protection of Fiber-Reinforced Polymer-Wrapped
Concrete: Feasibility of Impact-Generated Rayleigh-Waves (107-M36)
Reinforced Concrete (107-M40) Gadve, S.; Mukherjee, A.; and Malhotra, S. N.,
RE SINS wa'siscd dan scestnssavenvackedewtpaaeeheainy 305
PN Ns 5 Saran ane arr seohed eet cae tw nin pee ane 349
Monteiro, P. J. M.
Maximum aggregate size Size and Wall Effects on Compressive Strength
of Concretes (107-M43) Turkel, A., and Ozkul, M. H., July-Aug. —Electrical Resistance Tomography for Assessment of Cracks in Concrete
BE cds a cite pada uke ea weed hiked Netix hie aba ceh ba keen 372 (107-M60) Sept.-Oct. 2010
—TInstantaneous In-Situ Determination of Water-Cement Ratio of Fresh
Measurement of Oxygen Permeability of Epoxy Polymers (107-M18)
Concrete (107-M66) Nov.-Dec. 2010
Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Mar.-Apr.
Moore, J. R. Instantaneous In-Situ Determination of Water-Cement Ratio
of Fresh Concrete (107-M66) Nov.-Dec. 2010
Mechanical properties Carbon-Fiber Cement-Based Materials for
Electromagnetic Shielding (107-M68) Muthusamy, S., and Chung, D. D. L., Morris, P. H. Performance of Permeability-Reducing Admixtures in
Nov.-Dec. 2010 Marine Concrete Structures (107-M34) May-June 2010
Meddah, M. S. Effect of Curing Methods on Autogenous Shrinkage and Mortar
Self-Induced Stress of High-Performance Concrete (107-M10) Jan.-Feb. —Analysis of Mortar Long-Term Strength with Supplementary
Cementitious Materials Cured at Different Temperatures (107-M37)
Mehta, P. K. Salt Weathering of Concrete by Sodium Carbonate and Sodium Ezziane, K.; Kadri, E.-H.; Bougara, A.; and Bennacer, R., July-Aug.
Chloride (107-M30) May-June 2010
—Effect of Bottom Ash as Fine Aggregate on Shrinkage Cracking of
Mercury porosimetry Effect of Age and Water-Cement Ratio on Size and
Mortars (107-M08) Topgu, I. B., and Bilir, T., Jan.-Feb. 2010
Dispersion of Pores in Ordinary Portland Cement Paste (107-M19)
Kondraivendhan, B., and Bhattacharjee, B., Mar.-Apr. 2010 —Effect of Non-Ground-Granulated Blast-Furnace Slag as Fine Aggregate
on Shrinkage Cracking of Mortars (107-M61) Topgu, I. B., and Bilir, T.,
Method New Method for Proportioning Self-Consolidating Concrete Based
Nov.-Dec. 2010
on Compressive Strength Requirements (107-M56) Kheder, G. F., and
Al Jadiri, R. S., Sept.-Oct. 2010 Mostofinejad, D. Environmental Effects on Mechanical Properties of Wet
Lay-Up Fiber-Reinforced Polymer (107-M31) May-June 2010
Methylene blue Detection of Aggregate Clay Coatings and Impacts on
Concrete (107-M45) Mufioz, J. F.; Tejedor, M. I.; Anderson, M. A.; and Mukherjee, A. Corrosion Protection of Fiber-Reinforced Polymer-
Cramer, S. M., July-Aug. 2010 Wrapped Reinforced Concrete (107-M40) July-Aug. 2010
Multiple cracks Bidirectional Multiple Cracking Tests on High-Performance
MgO-based expansive agent Potential Approach to Evaluating Soundness
of Concrete Containing MgO-Based Expansive Agent (107-M13) Mo, L.; Fiber-Reinforced Cementitious Composite Plates (107-M51) Suryanto, B.;
Deng, M.; and Tang, M., Mar.-Apr. 2010 Nagai, K.; and Maekawa, K., Sept.-Oct. 2010
Mujfioz, J. F. Detection of Aggregate Clay Coatings and Impacts on
Microfines Detection of Aggregate Clay Coatings and Impacts on Concrete
(107-M45) Mufioz, J. F.; Tejedor, M. L.; Anderson, M. A.; and Cramer, S. M., Concrete (107-M45) July-Aug. 2010
July-Aug. 2010 Muthusamy, S. Carbon-Fiber Cement-Based Materials for Electromagnetic
Shielding (107-M68) Nov.-Dec. 2010
Microstructure
Myint-Lay, K. Early-Age Shrinkage Strains Versus Depth of Low Water-
—Assessing Mechanical Properties and Microstructure of Fire-Damaged
Cement Ratio Mortar Prisms (107-M25) May-June 2010
Engineered Cementitious Composites (107-M35) Sahmaran, M.; Lachemi, M.;
and Li, V. C., May-June 2010
—Correlation of Reaction Products and Expansion Potential in Alkali-
Silica Reaction for Blended Cement Materials (107-M44) Bonakdar, A.;
Mobasher, B.; Dey, S. K.; and Roy, D. M., July-Aug. 2010 ........ 380 Nagai, K. Bidirectional Multiple Cracking Tests on High-Performance
Mineral admixtures Models for Chloride Diffusion Coefficients of Fiber-Reinforced Cementitious Composite Plates (107-M51) Sept.-Oct.
Concretes in Tidal Zone (107-M01) Bermudez, M. A., and Alaejos, P.,
Jan.-Feb. 2010 Natural pozzolan Analysis of Mortar Long-Term Strength with Supplementary
Mixture proportioning Cementitious Materials Cured at Different Temperatures (107-M37)
—New Method for Proportioning Self-Consolidating Concrete Based Ezziane, K.; Kadri, E.-H.; Bougara, A.; and Bennacer, R., July-Aug.
on Compressive Strength Requirements (107-M56) Kheder, G. F., and
Al Jadiri, R. S., Sept.-Oct. 2010 Neff, M. Salt Weathering of Concrete by Sodium Carbonate and Sodium
—New Methodology to Proportion Self-Consolidating Concrete with High- Chloride (107-M30) May-June 2010
Volume Fly Ash (107-M26) Chowdhury, S., and Basu, P. C., May-June NeithN.a Plalnara Itmaghe-B,ase d Reconsotf Prervuioucs tConicreote nPo re
Structure and Permeability Prediction (107-M48) July-Aug. 2010
ACI Materials Journal/March-April 2011 655
Neji, J. Compacted Sand Concrete in Pavement Construction: An Economical Ozkul, M. H. Size and Wall Effects on Compressive Strength of Concretes
and Environmental Solution (107-M24) Mar.-Apr. 2010. . (107-M43) July-Aug. 2010
Neptune, A. I. Effect of Aggregate Size and Gradation on Pervious
Concrete Mixtures (107-M71) Nov.-Dec. 2010 sat Wie ak . 625
New Method for Proportioning Self-Consolidating Concrete Based on
Compressive Strength Requirements (|07-M56) Kheder, G. F., and Passive protection Corrosion Protection of Fiber-Reinforced Polymer-
Al Jadiri, R. S., Sept.-Oct. 2010 .... : _ 490
Wrapped Reinforced Concrete (107-M40) Gadve, S.; Mukherjee, A.; and
New Methodology to Proportion Self-C onsolidating Concrete with Malhotra, S. N., July-Aug. 2010
High-Volume Fly Ash (107-M26) Chowdhury, S., and Basu, P. C., Patodi, S. C. Interface Tailoring of Polyester-Type Fiber in Engineered
May-June 2010 ..... re:
Cementitious Composite Matrix against Pullout (107-M15) Mar.-Apr.
New Viscoelastic Model for Early-- Age Concrete Based on Mennuved 2010.
Strains and Stresses (107-M28) Choi, S. C., and Oh, B. H., May-June
Pavate, T. V. Inclined Plane Test to Evaluate Structural Buildup at Rest of
2010 ica
Self-Consolidating Concrete (107-M59) Sept.-Oct. 2010 .......... 515
Nogueira, C. L. Wavelet Analysis of Ultrasonic Pulses in ce ment-Based
Pavements Compacted Sand Concrete in Pavement Construction: An
Materials (107-M29) May-June 2010 oceelsaacee
Economical and Environmental Solution (107-M24) El Euch Khay, S.;
Nokken, M. R. Expansion of MgO in Cement Pastes Measured by Different Neji, J.; and Loulizi, A., Mar.-Apr. 2010
Methods (107-M12) Jan.-Feb. 2010 80
Peng, T. Corrosion Process of Steel Bar in Concrete in Full Lifetime
Nondestructive evaluation Inspection of Concrete Us ing Air-Coupled (107-M63) Nov.-Dec. 2010. Pe eee ee
Ultrasonic Pulse Velocity (107-M20) Cetrangolo, G. P., and Popovics,J . S.,
Percolation Triple Percolation in Concrete Reinforced with Carbon Fiber
Mar.-Apr. 2010 . 155
(107-M46) Baeza, F. J.; Chung, D. D. L.; Zornoza, E.; Andién, L. G.; and
Nondestructive testing Re Wo UE I 9:8 ced Aicinw Gama daldehice cw team we en 396
Characterization of Deep Surface-Opening Cracks in Concrete: Feasibility Performance Investigation of Alkali-Silica Reaction Inhibited by New
of Impact-Generated Rayleigh-Waves (107-M36) Chai, H. K.; Momoki, S.; Lithium Compound (107-M06) Mo, X.; Zhang, Y.; Yu, C.; Deng, M.;
Aggelis, D. G.; and Shiotani, T., May-June 2010 ee Tang, M.; Hiinger, K.-J.; and Fournier, B., Jan.-Feb. 2010 .......... 37
Electrical Resistance Tomography for Assessment of Cracks in Concrete
Performance of Cast-in-Place Self-Consolidating Concrete Made with
(107-M60) Karhunen, K.; Seppanen, A.; Lehikoinen, A.; Blunt,J .;K aipio, J. P.;
Various Types of Viscosity-Enhancing Admixtures (107-M47)
and Monteiro, P. J. M., Sept.-Oct. 2010 ‘ a . 523
Khayat, K. H.; Hwang, S.-D.; and Belaid, K., July-Aug. 2010
Inspection of Concrete Using Air-Coupled Ultrasonic Pulse Velocity
Performance of Permeability-Reducing Admixtures in Marine
(107-M20) Cetrangolo, G. P., and Popovics, J. S., Mar.-Apr. 2010 155
Concrete Structures (107-M34) Dao, V. T. N.; Dux, P. F.; Morris, P. H.;
Instantaneous In-Situ Determination of Water-Cement Ratio of Fresh and Carse, A. H., May-June 2010
Concrete (107-M66) Mancio, M.; Moore, J. R.; Brooks, Z.; Monteiro, P. J. M.;
Periclase Expansion of MgO in Cement Pastes Measured by Different
and Glaser, S. D., Nov.-Dec. 2010 586
Methods (107-M12) Nokken, M. R., Jan.-Feb. 2010
Numerical Simulation of Stress Waves on Surface of Strongly
Permeability
Heterogeneous Media (107-M53) Aggelis, D. G., Sept.-Oct. 2010 469
—Effect of Aggregate Size and Gradation on Pervious Concrete Mixtures
Suitability of Various Measurement Techniques for Assessing Corrosion (107-M71) Neptune, A. L., and Putman, B. J., Nov.-Dec. 2010... .. . 625
in Cracked Concrete (107-M55) Otieno, M. B.; Alexander, M. G.; and
—Measurement of Oxygen Permeability of Epoxy Polymers (107-M18)
Beushausen, H. D., Sept.-Oct. 2010 er
Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Mar.-Apr.
Wavelet Analysis of Ultrasonic Pulses in Cement- Based Materials 2010.
(107-M29) Nogueira,C . L., May-June 2010 : 248
Stee Image-Based Rescuntention of Pervious Concrete Pore Structure
Nonstress cylinder Thermal Strain and Drying Shrinkage of Concrete
and Permeability Prediction (107-M48) Sumanasooriya, M. S.; Bentz, D. P.;
Structures in the Field (107-M57) Choi, S., and Won, M. C., Sept.-Oct
and Neithalath, N., July-Aug. 2010. . .
2010 498
Permeability-reducing admixture Performance of Permeability-Reducing
Numerical Simulation of Stress Waves on Surface of Strongly
Admixtures in Marine Concrete Structures (107-M34) Dao, V. T. N.;
Heterogeneous Media (|(07-M53) Aggelis, D. G., Sept.-Oct. 2010 469
Dux, P. F.; Morris, P. H.; and Carse, A. H., May-June 2010 ........ 291
Pervious concrete
Oo —Calcium Hydroxide Formation in Thin Cement Paste Exposed to Air
(107-M42) Haselbach, L. M., and Liu, L., July-Aug. 2010 ........ . 365
Oh, B. H. —Effect of Aggregate Size and Gradation on Pervious Concrete Mixtures
Modeling Mechanical Behavior of Reinforced Concrete due to Corrosion (107-M71) Neptune, A. I., and Putman, B. J., Nov.-Dec. 2010
of Steel Bar (107-M14) Mar.-Apr. 2010 ; 106 —Planar Image-Based Reconstruction of Pervious Concrete Pore Structure
New Viscoelastic Model for Early-Age Concrete Based on Measured and Permeability Prediction (107-M48) Sumanasooriya, M. S.; Bentz, D. P.;
Strains and Stresses (107-M28) May-June 2010 239 and Neithalath, N., July-Aug. 2010.
Omran, A. F. Inclined Plane Test to Evaluate Structural Buildup at Rest of Phase velocity Wavelet Analysis of Ultrasonic Pulses in Cement-Based
Self-Consolidating Concrete (107-M59) Sept.-Oct. 2010 515 Materials (107-M29) Nogueira, C. L., May-June 2010 ............ 248
O'Neill, R. Salt Weathering of Concrete by Sodium Carbonate and Sodium Phithaksounthone, A. Synergistic Effect between Glass Frit and Blast-
Chloride (107-M30) May-June 2010 v<70aee Furnace Slag (107-M11) Jan.-Feb. 2010
Ong, K. C. G. Early-Age Shrinkage Strains Versus Depth of Low Water- Phung, Q. T. Intrinsic Model to Predict Formwork Pressure (107- M03)
Cement Ratio Mortar Prisms (107-M25) May-June 2010 213 Jan.-Feb. 2010 Finan & Fh occa aaa aa aiare hater 20
Opening-sliding Bidirectional Multiple Cracking Tests on High-Performance Physical salt attack Salt W wuthe ring of Concrete by Sodium Carbonate and
Fiber-Reinforced Cementitious Composite Plates (107-M51) Suryanto, B.; Sodium Chloride (107-M30) Haynes, H.; O'Neill, R.; Neff, M.; and
Nagai, K.; and Maekawa, K., Sept.-Oct. 2010 , exacaOe FsWig EN E DU sais ccngcapenaceataceesudvedevanee
Orthogonal Hybrid Rotating/Fixed-Crack Model for High-Performance Planar Image-Based Reconstruction of Pervious Concrete Pore Structure
Fiber-Reinforced Cementitious Composites (107-M64) Hung, C.-C., and and Permeability Prediction (| 07-M48) Sumanasooriya, M. S.; Bentz, D. P.;
El-Tawil, S., Nov.-Dec. 2010 : ; .. 568 and Neithalath, N., July-Aug. 2010
Otieno, M. B. Suitability of Various Measurement Techniques for Plane stress Hybrid Rotating/Fixed-Crack Model for High-Performance
Assessing Corrosion in Cracked Concrete (107-M55) Sept.-Oct. Fiber-Reinforced Cementitious Composites (107-M64) Hung, C.-C., and
2010 Javan . 481 a SE: CD's 6 3 ova nwaekehennmadaliesniiem enae 568
Oxygen Measurement of Oxygen Permeability of Rpeny Polymers Plastic viscosity Performance of Cast-in-Place Self-Consolidating Concrete
(107-M18) Khoe, C.; Chowdhury, S.; Bhethanabotla, V. R.; and Sen, R., Made with Various Types of Viscosity-Enhancing Admixtures (107-M47)
Mar.-Apr. 2010 Khayat, K. H.; Hwang, S.-D.; and Belaid, K., July-Aug. 2010
656 ACI Materials Journal/March-April 2011