Table Of ContentORIGINALRESEARCHARTICLE
published:16January2013
doi:10.3389/fgene.2012.00321
Characterizing differential individual response to porcine
reproductive and respiratory syndrome virus infection
through statistical and functional analysis of gene
expression
MariaE.Arceo1,CatherineW.Ernst1,JoanK.Lunney2,IgseoChoi2,NancyE.Raney1,
TinghuaHuang3,ChristopherK.Tuggle3,R.R.R.Rowland4 andJuanP.Steibel1,5*
1DepartmentofAnimalScience,MichiganStateUniversity,EastLansing,MI,USA
2AnimalParasiticDiseasesLaboratory,UnitedStatesDepartmentofAgriculture,AgricultureResearchService,Beltsville,MD,USA
3DepartmentofAnimalScience,IowaStateUniversity,Ames,IA,USA
4DepartmentofDiagnosticMedicineandPathobiology,KansasStateUniversity,Manhattan,KS,USA
5DepartmentofFisheriesandWildlife,MichiganStateUniversity,EastLansing,MI,USA
Editedby: We evaluated differences in gene expression in pigs from the Porcine Reproductive
PeterDovc,UniversityofLjubljana, and Respiratory Syndrome (PRRS) Host Genetics Consortium initiative showing a range
Slovenia of responses to PRRS virus infection. Pigs were allocated into four phenotypic groups
Reviewedby: according to their serum viral level and weight gain. RNA obtained from blood at 0, 4, 7,
ElisabettaGiuffra,InstitutNational
11,14,28,and42dayspost-infection(DPI)washybridizedtothe70-mer20KPigoligoarray.
delaRechercheAgronomique,
France We used a blocked reference design for the microarray experiment. This allowed us to
AlessandraStella,IstitutodiBiologia accountforindividualbiologicalvariationingeneexpression,andtoassessbaselineeffects
eBiotecnologiaAgrariaConsiglio before infection(0DPI). Additionally,this designhas the flexibilityof incorporating future
NazionaledelleRicerche,Italy
data for differential expression analysis. We focused on evaluating transcripts showing
*Correspondence:
significant interaction of weight gain and serum viral level. We identified 491 significant
JuanP.Steibel,Departmentof
AnimalScienceandDepartmentof comparisons [false discovery rate (FDR) = 10%] across all DPI and phenotypic groups.
FisheriesandWildlife,Michigan We corroborated the overall trend in direction and level of expression (measured as fold
StateUniversity,1205AnthonyHall, change)at4DPIusingqPCR(r =0.91,p≤0.0007).At4and7DPI,networkandfunctional
EastLansing,MI48824, USA.
analyseswereperformedtoassessifimmunerelatedgenesetswereenrichedforgenes
e-mail:[email protected]
differentially expressed (DE) across four phenotypic groups. We identified cell death
function as being significantly associated (FDR ≤ 5%) with several networks enriched
forDEtranscripts.Wefoundthegenesinterferon-alpha1(IFNA1),majorhistocompatibility
complex, class II, DQ alpha 1 (SLA-DQA1), and major histocompatibility complex, class
II, DR alpha (SLA-DRA) to be DE (p≤0.05) between phenotypic groups. Finally, we
performed a power analysisto estimate sample size and samplingtime-points for future
experiments.WeconcludedthebestscenarioforinvestigationofearlyresponsetoPRRSV
infectionconsistsofsamplingat0,4,and7DPIusingabout30pigsperphenotypicgroup.
Keywords: porcine reproductive and respiratory syndrome, microarray, quantitative PCR, functional analysis,
poweranalysis
INTRODUCTION Theseauthorsreporteddifferencesinclinicalsymptomsandlung
PorcineReproductiveandRespiratorySyndrome(PRRS)wasini- pathologyinresponsetoPRRSVinfection,aswellasinviruslev-
tially described inthe USover20yearsago(Doneet al.,1996). elsinserumand/orrespiratorytissues,suchaslungandbronchial
Overall,the diseasecauses$664millionannuallossesto theUS lymphnodes.Doeschl-Wilsonetal.(2009)andPetryetal.(2005)
pork industry (Holtkamp et al., 2012). A virus, now known as alsoreporteddifferentialbodyweightchangesinPRRSVinfected
PorcineReproductiveandRespiratorySyndromeVirus(PRRSV), pigs. A possible way of reducing PRRS incidence would be to
hasbeenidentifiedastheprimarycausativeagent(Collinsetal., breed pigs that are more resistant to the disease. To this end,
1992). Viral replication takes place in the host’s immune cells hostgeneticresponsetoinfectioncanbestudiedusingcurrently
(Rowlandet al.,2003;Geninietal.,2008)thereby, reducingthe available genomic tools (Lewis et al., 2007; Lunney and Chen,
cytokine-mediated inflammatoryresponse.Whilethemolecular 2010).
pathways involved in the protection against PRRS have not yet Studying gene expression in pigs showing phenotypic varia-
beenentirelyelucidated(Kimmanetal.,2009),phenotypicvari- tiontoPRRSVinfectionresponseswillenhanceourknowledgeof
ation between breed-lines has been observed in disease-related geneticcontrolofthesusceptibilitytothisdisease.Inthiscontext,
and production traits of experimentally infected pigs (Petry differential expression of a reduced number of immune related
et al., 2005; Vincent et al., 2006; Doeschl-Wilson et al., 2009). geneshasbeenevaluated(Petryetal.,2007;Lunneyetal.,2010)
www.frontiersin.org January2013|Volume3|Article321|1
Arceoetal. DifferentialgeneexpressiontoPRRSV
andglobaldifferentialexpressionhasbeenassessedinvivo(Bates Blood samples were collected in Tempus™ Blood RNA Tubes
etal.,2008;Xiaoetal.,2010a,b;Zhouetal.,2011;Wysockietal., (Life Technologies, Carlsbad, CA) at 0, 4, 7, 11, 14, 19, 28,
2012) and in vitro (Lee et al., 2004a,b; Miller and Fox, 2004; 35, and 42 days post-infection (DPI). We followed the manu-
Geninietal.,2008;Ait-Alietal.,2011). facturer’s standard RNA purification protocol including DNase
Most previous studies focused on comparing gene expres- treatment to obtain blood RNA and remove any remaining
sion of PRRSV-infected and uninfected pigs, as well as gene genomic DNA. Serum viral level was quantified using a semi-
expressionbetweenanimalsshowingdifferencesinpost-infection quantitative TaqMan®PCR assay. Individual animal weight was
viral titers. However, little is known of the interaction between measuredatweeklyintervals.Moredetailsonthepigresources,
viral load (VL) and weight gain as it relates to gene expression study design and data storage are in Lunney et al. (2011) and
post-infection. Thisisparticularlyimportantgiventhereported Boddickeretal.(2012).ThestudywasapprovedbyKansasState
associations of immune traits with growth rate (Galina-Pantoja UniversityInstitutionalAnimalCareandUseCommittee.
et al., 2006; Boddicker et al., 2012) and the genetic correlations
between growth rate and disease traits (Doeschl-Wilson et al., PHENOTYPICGROUPS
2009)aswell asbetween growthrateandimmunerelated traits Figure1showsascatterplotofweightgainvs.VLforallpigsfrom
(Clappertonetal.,2009). PHGCtrialone.Fourphenotypicgroupsweredefinedaccording
Furthermore, most previous studies assessed differential tothepigs’weightgainandVL.Weightgainwasdefinedasbody
expression of specific virus target tissues or cells. In addition, weight(kg)from0to42DPI.VLwasdefinedastheareaunderthe
differentresearchershaveaddressedtheabilityofthebloodtran- curveofthelog-transformedserumvirallevelfrom0to21DPI.
scriptome to reflect the transcriptome of other body tissues in Thechoiceoftime-pointstodefineVLwasbasedonobservations
humans (Liew et al., 2006; Mohr and Liew, 2007; Kohane and ofvirallevelsovertimefor565pigsacrossthree infection trials
Valtchinov, 2012). In our system, identifying differential gene (Boddickeretal.,2012).Theseresultsshowedthatthemajorityof
expressioninwholebloodinresponsetoPRRSVinfectionwould challengedpigshadpeakviremiafrom4to21DPI(Lunneyetal.,
facilitate genome testing and diagnosis of suceptibility to the 2011). Viremia past 21DPI wasnot taken into account because
disease. the viral levels rebounded in ∼33% of pigs (Boddicker et al.,
The availability of whole genome microarrays (Steibel et al., 2012). Since for these infection trials pigs were followed until
2009c) and next generation sequencing (Mardis, 2008) have 42DPI it was most advantageous to follow weight gain for the
further favored whole genome expression profiling of PRRSV moreextendedtime(42DPI).Thetwovariables(VLandweight
infected animals(Xiaoetal.,2010a,b).Importantfeatureswhen gain) showed moderate negative correlation(r=−0.29). Thus,
evaluating gene expression are: (1) the correct modeling of the bivariatedataofVLandweightgainwerecenteredattheirmean
phenotypic variation and the inclusion of biological replica-
tion (Rosa et al., 2005) and (2) sampling relevant tissues and
time-points(MateuandDiaz,2008;Lunneyetal.,2010).
We evaluated whole-genome expression profile of pigs
assigned to four reaction groups (phenotypic groups) accord-
ing to the pigs’ weight gain and VL as part of the PRRS Host
Genetics Consortium (PHGC) (Lunney et al., 2011). The goals
of this study were: (1) to assess global differential gene expres-
sion in whole blood of commercial pigs showing variation in
phenotypic response to PRRSV experimental infection, and to
identify relevant molecular networks and biological functions
enriched for differentially expressed (DE) genes involved in the
pig’simmuneresponsetoPRRSVinfection;and(2)toinformthe
designoffutureexperiments,todeterminethemostinformative
early time-points and sample sizes required for powerful infer-
enceswhenassessinggeneexpressioninbloodofcommercialpigs
experimentallyinfectedwithPRRSV.
MATERIALSANDMETHODS
ANIMALMODELANDSTUDYDESIGN
Crossbredcommercialpigs(∼200)fromPHGCtrialone(Lunney
etal.,2011)weretransportedtotheKansasStateUniversitybio-
FIGURE1|Scatterplotofweightgainvs.viralloadforallpigsinPHGC
securetesting facilityatweaning(11–21daysold)andallocated
trialone.Eachdotrepresentsapig.Colorshadingsindicatethefour
to pens (10–15 pigs/pen). Pigs came from PRRSV-, Influenza differentphenotpypicgroups(HvHg,HvLg,LvHg,andLvLg).Darkcolor
virus-andMycoplasmahyopneumoniae-freefarms.Aftera7-days indicatespigsthatwereclassifiedintooneofthegroups.Lightcolor
acclimation period and antibiotic treatments, pigs were both indicatespigsthatwerenotclassifiedbecausetheylayintheboundaryof
thegroups.Circlesindicatepigsthatwereselectedfortranscriptional
intramuscularlyandintranasallyinfectedwithaknownisolateof
profilinginthisexperiment.
PRRSV (105 tissue culture infectious dose of NVSL97-7985).
50
FrontiersinGenetics|LivestockGenomics January2013|Volume3|Article321|2
Arceoetal. DifferentialgeneexpressiontoPRRSV
valuesandrotated toobtainuncorrelated measures.Phenotypic for each DPI, the interaction effect TG was tested at 10%
ij
groupswerethenspecified asacombinationofthesetwo traits: false discovery rate (FDR) (Storey, 2003). Then, for all tran-
(1) high VL-high weight gain (HvHg), (2) high VL-low weight scripts with significant interaction, the effect of VL was eval-
gain (HvLg), (3) low VL-high weight gain (LvHg), and (4) low uated in high-weight-gain and low-weight-gain pigs, separately
VL-lowweightgain(LvLg). Forallocationto thesefourgroups, (nominal p≤1/Ns, with Ns = number of significant inter-
pigs that were within one standard deviation of the population actions). Similarly, the effect of weight gain was evaluated in
mean for either of the traits was discarded and the remaining high-viral-loadandlow-viral-loadpigs,separately.
animalswereclassifiedtooneofthegroups(Figure1). All in all, this testing protocol resulted in 4 contrasts of
interest for the comparisons of phenotypic groups. Each con-
MICROARRAYDESIGNANDANALYSIS trastinvolvedthecomparisonoftwophenotypicgroups.Twoof
Three pigs per group were randomly selected and their RNA these contrastsevaluatedthe effect ofVLand theothertwo the
isolatedusingtheTempus™SpinRNAIsolationKitasperman- effect of weight gain. In particular, for the VL effect, we com-
ufacturer’s instructions (Applied Biosystems/Life Technologies) pared(1)HvHgvs. LvHgand(2)HvLgvs. LvLg.Toevaluatethe
from blood at 0, 4, 7, 11, 14, 28, and 42DPI. RNA samples weightgaineffect,wecompared(1)HvHgvs. HvLgand(2)LvHg
were reverse transcribed using the Amino Allyl MessageAmp II vs. LvLg.
aRNA Amplification Kit (Ambion./Life Technologies), labeled Data have been deposited in NCBI’s Gene Expression
with N-hydroxysuccinate (NHS) ester Cy3 or Cy5 dyes (GE Omnibus (GEO) (http://www.ncbi.nlm.nih.gov/geo/) with
Healthcare, CA), and hybridized to the 20K 70-mer oligonu- accession number GSE41144. Code used for these analyses can
cleotide Pigoligoarray as previously described (Steibel et al., befoundathttps://www.msu.edu/∼ steibelj/JP_files/PRRSV.html.
2009c) following a block reference design (Steibel and Rosa,
2005).Eachindividualpig’s0-DPI-sampleservedasreferencefor PATHWAYANALYSIS
all other samples from the same animal. Reference sample dye Gene set enrichment analyses were performed using Ingenuity
flippingwasperformedacrosspigstoallowseparationofdyeand Pathways Analysis software (IPA; Ingenuity® Systems,
0-DPI effects (Steibel and Rosa, 2005). Fluorescent images and www.ingenuity.com). Annotation for the oligonucleotides
fluorescenceintensitydatawerecollectedaspreviouslydescribed present in the microarray is available from http://www.
(Steibel et al., 2009c). Median intensities were background cor- animalgenome.org/cgi-bin/host/Lunney/oligoAnnotatn. Details
rectedwithNormexpmethodfixingtheoffsetparameterκ=50 have been published in Steibel et al. (2009c). After statistical
(Ritchie et al., 2007). Background corrected data was normal- analyses described above pathway analyses were restricted to
ized usingawithinprint-tip loess-locationnormalization(Yang earlytime-points(4and7DPI).Thenetworkanalysesgenerated
et al., 2002). All computations were implemented in R (R asetofrelevantnetworks(p≤10−10andnumberofDEgenes≥
DevelopmentCoreTeam,2010)throughLIMMA(Smyth,2005). 5) built based on a user-specified list of genes. Networks were
Normalized log-intensities were analyzed on a transcript per composedofgenesandgeneproductsthatareknowntointeract
transcriptbasisusingalinearmixedmodelaccountingforallper- witheachotherandthatwereenrichedfortheDEtranscripts(as
tinent randomand fixed effects (Rosa et al., 2005) asdescribed definedinsection“Microarraydesignandanalysis”).Functional
below: analysisidentifiedthebiologicalfunctionsthatweresignificantly
enriched [Benjamini and Hochberg (1995) p<0.05] for these
yijklm =μ+TGij+Dl+Am+Sk+eijklm DEgenes.
where yijklm is the log-intensity measure at the ith DPI, for qPCRDESIGNANDANALYSIS
the kth pig corresponding to phenotypic group j in the mth Quantitative PCR (qPCR) analysis was used to assess differen-
array labeled with the lth dye; μ is the overall mean; TG tial expression of 15 genes. Twelve genes were selected from
ij
is the effect of DPI i and phenotypic group j in the expres- microarrayandpathwayanalysesresults.Inaddition,threegenes
sion of the transcript, with i=1,...,7 and j = 1,...,4;D [interferon-alpha 1(IFNA1); majorhistocompatibility complex,
l
is the effect of lth dye, with l=1,2; and A is the ran- class II, DQ alpha 1 (SLA-DQA1); and major histocompatibil-
m
dom effect of the mth array, with m=1,...,72 and A ∼ ity complex, class II, DR alpha (SLA-DRA)] not present in the
m
N(0,σ2);S is the random effect of the kth pig, with k= microarray platform were included based on previously doc-
a k
1,...,12 and S ∼N(0,σ2); finally e is the residual with umented knowledge of their relevant role in immune mod-
k s ijklm
e ∼N(0,σ2). ulation, reviewed by Lunney and Chen (2010). Probes and
ijklm e
The mixed model was fitted using the package MAANOVA primers were obtained from the Porcine Immunology and
(Wu et al., 2003). An F-test based on a shrinkage estimator of Nutrition Database (Dawson et al., 2005) or designed with
variance components was used to evaluate significance of fixed PrimerExpressSoftwarev3.0(LifeTechnologies)fromsequences
effects(Cuietal.,2005).Permutationbasedp-values(numberof obtained from Ensembl (http://useast.ensembl.org/index.html).
permutations=100) wereobtained to assesssignificance (Yang Primers and probeswere designed to spanexon-exon junctions
andChurchill,2006). whenever possible. Sequences for all primers and probes are
To account for multiple testing a two-stage testing proce- provided in TableA1. Synthesis of cDNA was performed with
dure was used to assess significance of gene expression changes SuperScriptReverseTranscriptase®andqPCRamplificationwas
in response to weight gain and VL status over time. First, implemented usingthe Brilliant Kit(Agilent Technologies, Inc.,
www.frontiersin.org January2013|Volume3|Article321|3
Arceoetal. DifferentialgeneexpressiontoPRRSV
CA)with35ngofcDNAinanABIPrism7500SequenceDetector uniformdistributionundernullhypothesis(Figure2).Theactual
System (Life Technologies). Assays were performed in dupli- distributionofp-valuesforLvHgvs.LvLgindicatedanexcessof
cate.TheamplificationconditionsaredescribedinRoyaeeetal. smallp-values.Thisisconsistentwiththealternativehypothesis
(2004).Ct valueswereobtainedfromeachindividualamplifica- ofdifferentialexpression.ThecontrastsHvHgvs.LvHgandHvLg
tion curve. Average Ct for each target gene in each sample and vs.LvLgshowedp-valuedistributionsinconsistentwithbothnull
DPI (4 and 7) were subtracted from the corresponding average and alternative hypotheses implicit in the analysis model (Page
CtofRPL32(housekeepinggene),producing(cid:2)Ctvalues.(cid:2)(cid:2)Ct etal.,2006).Theobserveddeviationsinthep-valuedistributions
values were computed by subtracting 0-DPI-(cid:2)Ct from (cid:2)Ct at of these tests likely reveal the existence of unaccounted effects
eachDPI.Resulting(cid:2)(cid:2)CtwereanalyzedseparatelyforeachDPI (Page et al., 2003). These patterns also appeared in contrasts
(except0DPI)withthefollowinglinearmodel: at other time-points if these differences at 0DPI were ignored
(resultsnotshown).
y =G +e
m m m
EvidenceofdifferentialgeneexpressionforremainingDPI
wherey isthe(cid:2)(cid:2)Ct valueforthegeneinthemth phenotypic Basedontheresultsfromtheprevioussection,differentialexpres-
m
group, G is the effect of the phenotypic group m and e ∼ sion between phenotypic groups after 0DPI was corrected by
m m
N(0,σ2)istheresidual.Thismodelisequivalenttoapreviously subtracting the estimated difference at 0DPI. For example, to
e
describedlinearmodel(Steibeletal.,2009a). addressdifferentialexpressionbetweentwophenotypicgroupsof
pigs,theeffectwasestimatedfollowing[(TGi(cid:5)=0,j−TGi(cid:6)=0,j)−
STATISTICALPOWERANDSAMPLESIZECOMPUTATION (TGi(cid:5)=0,j(cid:6) −TGi(cid:6)=0,j(cid:6))]. The same procedure was used for all
Using this experiment’s dataset as pilot data for future experi- contrasts. After correcting for 0-DPI estimated effect, the dis-
mentswithasimilardesign,wecomputedtheexpecteddiscovery tribution of p-values for all contrasts was consistent with the
rate(EDR)andFDRasdefinedbyGadburyetal.(2004)toesti- expecteddistributionundereithernulloralternativehypotheses
mate statistical power at a fixed number of biological replicates (data not shown). This indicated that correcting each compari-
(n)andtypeIerrorrate(α). TheEDRisthemulti-testequivalent sonestimatebythecorrespondingestimateattimezeroaccounts
to power, which is also called sensitivity (Steibel et al., 2009b). forpre-existingdifferencesingeneexpressionand/orforanimal
EDR should be computed at a specific nominal type I error specific effects missed bythemodel. Consequently, webasedall
rate, α, and for a given sample size, conditioning on estimated inferencesontheabovespecifiedcontrasts.
effects from a previous experiment (Gadbury et al., 2004). We Evidence of differential expression was found, as revealed by
consideredeithern=20 orn=30perphenotypicgroup(four the q–q plot of p-values (Figure3). This plot represents the
groups)andα=0.01.ThischoiceofαresultedinaFDR<10% quantilesoftheempiricaldistributionofp-valuesvs.theexpected
inallcases.ComputationswereperformedusingPowerAtlassoft- quantilesofuniformlydistributedp-values(correspondingtothe
ware (Page et al., 2006). Sample sizes were selected assuming a null hypothesis). The represented departure from the straight
common reference design with either 4 (n=20) or 3 (n=30) line y=x indicates an excess of small p-values as compared to
samplingtime-points, suchthatthetotalnumberofmicroarray the expectation under the null hypothesis, consistent with the
slideswasfixedto240.Thisrepresentsacommonsituationwhere alternativehypothesis.
the researcher has to decide whether to allocate arrays to extra
biological samples with fewer time-points or to include more Weightgainandviralloadinteractioneffectongeneexpression
time-pointsattheexpenseofsamplesizeforagiventotalbudget. Thenumberoftranscriptsshowingasignificantinteractionwas
288,14,177,and12at4,7,14,and42DPIrespectively(Table1).
RESULTS Therewerenosignificantinteractionsdetectedat11and28DPI.
DyelabeledcDNApreparedfrombloodsamplesfrom12PHGC Transcripts showing significant weight gain and VL interaction
pigsatsevendifferenttimepoints(0,4,7,11,14,28,and42DPI) effect ontheir expressionwere further evaluatedandresults are
were hybridized to the Pigoligoarray using a block reference presented in section “Weight gain and viral load effect on gene
design.Threepigspergroupwererandomlyselectedfromeachof expression.”
thefourphenotypicgroupsdefinedaccordingtothepigs’weight
gainandVL(HvHg,HvLg,LvHg,andLvLg).Weaddressedglobal Weightgainandviralloadeffectongeneexpression
differential expression in four contrasts of interest (HvHg vs. TodeclareaDEtranscriptweusedanadjustedp-valuewherethe
LvHg,HvLgvs.LvLg,HvHgvs.HvLg,andLvHgvs.LvLg). nullhypothesiswasrejectedifp≤1/Ns,withNs=totalnumber
of transcripts being tested (i.e., with a significant interaction at
MICROARRAYANALYSIS thespecificDPIbeingevaluated),suchthatweexpectedonefalse
Evidenceofdifferentialgeneexpressionat0DPI positive percomparison.Thisledto anumberofputativelyDE
Thepresenceofaneffectongeneexpressionprofilethatcannot transcriptsperDPIandcomparison,asshowninTable1.At4and
beattributedtotheexperimentalinfectionwasaddressedbyeval- 14DPI,weobservedasimilarnumberofDEtranscripts,consist-
uatingdifferential geneexpressionbetween the fourphenotypic ing ofa largenumber oftranscripts with significant interaction
groupsat0DPI.Althoughnosignificantdifferencesintranscripts (288 and 177 respectively) mainly involving differential expres-
wereidentified (FDR≤0.1),inspection ofp-valuedistributions sioninHvHgvs.LvHg(86and106transcripts)andinLvLgvs.
for the four contrasts indicated a departure from the expected LvHg (141 and 120 transcripts). However, at 7 and 14DPI, the
FrontiersinGenetics|LivestockGenomics January2013|Volume3|Article321|4
Arceoetal. DifferentialgeneexpressiontoPRRSV
FIGURE2|Histogramofp-valuesforthefourcontrastsofinterestat0DPI.Foreachcontrastofinterest(HvHgvs.LvHg,HvLgvs.LvLg,HvHgvs.HvLg,
andLvHgvs.LvLg),thisfigureshowsthedistributionofp-valuesat0DPI.Foraconditionofnodifferentialexpressionthehistogramsshouldhaveaflattrend.
number of significant interactions is smaller (14 and 12) with statistical power and sample size estimation”). Following these
mostofthetranscriptsDEacrossallfourcontrasts.Althoughwe pathway analyses, and to limit the interpretation of results to
reportedthenumberofDEtranscriptsat42DPI,wedidnotfol- genes with large effects, in addition to the p-value threshold
low up on these results because responses at that late sampling described in section “Weight gain and viral load effect on gene
time-point could be due to a rebound of the viral replication expression,”weconsideredanabsolutefold-change(FC)thresh-
(Boddickeretal.,2012). oldequalto,orgreaterthan1.5.Forinstance,inaspecificcontrast
involvingtwogroups,thegeneexpressionlevelinthefirstpheno-
PATHWAYANALYSES typic group had to be 50% larger (or smaller) than the one in
Subsequentto testing for changes in global gene expression, we the second phenotypic group for a significantly DE gene to be
assessedifimmunerelatedgenesetswereenrichedforDEgenes considered. DE genes with a positive FC (larger than 1.5) were
across pigs from the four phenotypic groups. We performed consideredtobeover-expressed,andDEgeneswithanegativeFC
pathway analyses to identify relevant molecular networks and (smallerthan−1.5)wereconsideredtobeunder-expressedinthe
biological functions associated with such networks enriched for firstphenotypicgroupincludedinthecontrastequation.
the DE genes identified in section “Weight gain and viral load Several gene networks enriched for DE genes were recog-
effect on gene expression.” We restricted the analyses to 4 and nized for the four contrasts of interest. The significant func-
7DPIsince(1)wewereinterestedinearlyimmuneresponsesand tionalcategoriesidentified inthesenetworks, aswell asselected
(2)thesewerethetimesthatprovidedthemostpowertodetect DE genes associated with these categories are listed in Table2.
future differential expression (as shown in section “Microarray Cell Death function was significantly identified at 4 and 7DPI.
www.frontiersin.org January2013|Volume3|Article321|5
Arceoetal. DifferentialgeneexpressiontoPRRSV
qPCRANALYSIS
Verificationofmicroarrayfindings
Among a total of 96 comparisons for the 12 genes present in
the microarray and selected for qPCR (12 genes×4 pheno-
typic groups×2DPI), 26 significant comparisons (p ≤ 1/Ns,
as defined in section “Weight gain and viral load effect
on gene expression”) were detected by the microarray and
two were confirmed by the qPCR. Significant comparisons
occurred for nine genes: EPS15, EZR, GRLF1, GZMA, ITGB7,
JARID2, MERTK, PYCARD, and RASGRP1. The qPCR con-
firmed differential expression oftwo genes: JARID2and ITGB7.
JARID2 wasconfirmed in HvLgvs.LvLgat4DPI(p≤0.03 and
p≤0.0001 forQPCR andmicroarray,respectively). ITGB7 was
confirmedinLvHgvs.LvLgat7DPI(p≤0.007andp≤0.004).
We also evaluated the gene set correlations between microarray
and qPCR measured FC. From a measurement error perspec-
tive,theoveralltrendindirectionandamountofexpressionwas
validatedat4DPI(r =0.91,p≤0.0007),butnotat7DPI.
These results indicate that, although the rate of differential
expression validation of individual genes is limited, the overall
FIGURE3|UniformQ-Qplotforgeneexpressionofallcontrasts patternofdifferentialexpressionwasconfirmedforcomparisons
across4–42DPIaftercorrectingfor0DPIestimatedeffect.Thisplot
at4DPI.Consequently,enrichmentanalysis(networksandfunc-
representsthequantilesoftheempiricaldistributionofp-valuesvs.the
tions) identified at the earliest time-point are expected to be
expectedquantilesofuniformlydistributedp-values(correspondingtothe
nullhypothesis).Therepresenteddeparturefromthestraightliney=x reproducedinfutureexperiments.
indicatesanexcessofsmallp-valuesascomparedtotheexpectationunder
thenullhypothesis,consistentwiththealternativehypothesisofdifferential
Additionalgenes
expression.
Threegenesnotpresentonthemicroarraywerealsotestedusing
qPCR: IFNA1, major histocompatibility complex, class II, DQ
alpha1(HLA-DQA1/SLA-DQA1), and majorhistocompatibility
Table1|Numberofputativelydifferentiallyexpressedtranscripts.
complex, classII, DRalpha(HLA-DRA/SLA-DRA). SLAclassII
antigens are expressed in B and T cells, with numerous haplo-
Time(DPI) Ns Phenotypicgroupscomparisons
typesidentified throughoutdifferentpigpopulations,whichled
HvHgvs. HvLgvs. HvHgvs. LvLgvs. researchers to explore their association with disease responses
LvHg LvLg HvLg LvHg (Lunneyetal.,2009).IFNA1encodesforaninnatecytokine,and
hasbeenreportedtobemodulatedbyPRRSV(MateuandDiaz,
4 288 86 42 22 141
2008;Kimmanetal.,2009).SignificancelevelsandFCforthese
7 14 13 12 14 11
genesinallcomparisonsarepresentedinTable3.
14 177 106 25 38 120 At4DPI,IFNA1wassignificantlyDE(p≤0.05)whencomparing
42 12 12 12 9 12
HvLg–LvLgandHvHg–HvLg.
Numbers indicate differentially expressed genes per time and phenotypic At7DPI,IFNA1wassignificantlyDEinallcontrasts.SLA-DQA
groups’comparisons. wasDEinallcontrastsexceptforHvHgvs.HvLgandSLA-DRA
Ns,totalnumberoftranscriptsbeingtested(i.e.,withasignificantinteractionat wasDEinLvHgvs.LvLg.
thespecificDPIbeingevaluated).
MICROARRAYSTATISTICALPOWERANDSAMPLESIZEESTIMATION
In order to inform the design of future experiments, we com-
At4DPIweidentifiedmajorhistocompatibilitycomplex,classII, putedtheEDRpercontrastatearlyDPI.Weconsideredafuture
DR beta 1 (HLA-DRB1/SLA-DRB1) involved in the activity of experiment that would include sampling time = 0DPI plus
Th1cells,whichwasunder-expressedintheHvLgvs.LvLgcon- two or three other times, selected among 4, 7, and 11DPI. We
trast. At 7DPI, genes involved in the initiation of apoptosis assumed effect sizes estimated from this data, a fixed nominal
(PYD and CARD domain containing, PYCARD) and cytotoxi- errorrateα=0.01,andtwosamplesizes(n=30forthreesam-
city of T cells (Granzyme A, GZMA) were under-expressed in plingtime-pointsorn=20forfoursamplingtime-points).The
the HvHg vs. LvHg and HvHg vs. HvLg contrasts. PYCARD sample allocation (sampling fewer time points with more bio-
was over-expressed and associated with Genetic Disorder and logical replicates orvice versa) wouldrequire the same number
Imflammatory disease in HvLg vs. LvLg. GZMA was also asso- of microarray slides (240) and would roughly have the same
ciated with Cell Morphology in the LvHg vs. LvLg contrast cost. For evaluating which sampling time-points have to be
and with Cellular compromise in HvLg vs. LvLg, where it was included in a future study, we set the threshold of inclusion
over-expressed. to EDR > 80%. That is, the average probability of detecting
FrontiersinGenetics|LivestockGenomics January2013|Volume3|Article321|6
Arceoetal. DifferentialgeneexpressiontoPRRSV
Table2|FunctionalcategoriesenrichedforDEgenesat4and7DPI.
Contrast 4DPI 7DPI
Functional Genes(1) Functionalcategories Genes(1)
categories
HvHgvs.LvHg Celldeath,cell c-merproto-oncogene Celldeath(1*) PYDandCARD
morphology,cellular tyrosinekinase,MERTK(−); domaincontaining,
assemblyand Ezrin,EZR(+);Moesin, PYCARD(−);
organization,cellular MSN(−) GranzymeA,
function,and GZMA(−)
maintenance(5*)
HvLgvs.LvLg Organismal Majorhistocompatibility Geneticdisorder, PYDandCARD
development,cell complex,classII,DRbeta1, inflammatorydisease,cellular domaincontaining,
death(3*) HLA-DRB1/SLA-DRB1(−); compromise(1*) PYCARD(+);
JumonjiATrichinteractive GranzymeA,
domain,JARID2(−) GZMA(+)
HvHgvs.HvLg Noneidentified(1*) Celldeath(1*) PYDandCARD
domaincontaining,
PYCARD(−);
GranzymeA,
GZMA(−)
Hgvs.LvLg Noneidentified(7*) Cellmorphology(1*) GranzymeA,
GZMA(+)
Functionalcategories(FDR<5%)associatedwithsignificantnetworks(p≤10−10andnumberofDEgenes≥5).
(1)SelectedDEgenesassociatedwithfunctionalcategoriesat4DPI(adjustedp-value≤0.0035)and7DPI(adjustedp-value≤0.07).
(+)Over-expressedinthefirstphenotypicgroupinthecontrast.
(−)Under-expressedinthefirstphenotypicgroupinthecontrast.
*NumberofsignificantnetworksidentifiedinthespecificcontrastandDPI.
Table3|Testofimmunegeneexpressionforgenesnotpresentinthemicroarrayplatform.
DPI Symbol Viralcomparisons Growthcomparisons
HvHgvs.LvHg HvLgvs.LvLg HvHgvs.HvLg LvHgvs.LvLg
p-value FC p-value FC p-value FC p-value FC
IFNA 0.09 3.21 0.01 −6.67 0.02 5.45 0.05 −3.93
4 SLA-DQA 0.71 1.15 0.11 −1.92 0.71 1.15 0.11 −1.92
SLA-DRA 0.96 −1.03 0.62 −1.35 0.71 −1.25 0.42 −1.64
IFNA 0.04 3.25 0.02 −4.08 0.04 3.27 0.02 −4.05
7 SLA-DQA 0.04 1.32 0.01 −1.43 0.95 −1.01 0.00 −1.89
SLA-DRA 0.15 1.58 0.55 −1.20 0.40 −1.29 0.02 −2.45
ValuesinthetableincludesignificancelevelsandFCofgenes;boldedvaluesindicatesignificantcomparisonsandtheirFC.
an effect (assuming the effect is indeed present) to be larger onlyresultinonecontrast(HvLgvs.LvLg)havingEDR>80%
than 0.8. When n=30, two sampling time-points (other than (Table4).
0DPI) could be included. In that case, the best sampling com-
binationwouldbeat4and7DPI.Thiswouldprovideadequate DISCUSSION
power (EDR > 80%) to detect weight gain and VL effects in The first objective of this study was to assess global differential
all contrasts except for LvHg vs. LvLg. Changing the sampling geneexpressioninweanedpigsshowingvariationinweightgain
scheme to include 11DPI (with only 20 samples per pheno- and blood VL in response to PRRSV infection. To achieve this
typicgroup),wouldnotaddtothepurposeofhavingsufficient objective,fourreactiongroups(phenotypicgroups)ofpigswere
powerinthat contrast. Furthermore, samplingat11DPIwould evaluated. Our study is different from other PRRSV-response
www.frontiersin.org January2013|Volume3|Article321|7
Arceoetal. DifferentialgeneexpressiontoPRRSV
Table4|Expecteddiscoveryrate(EDR)comparing20and30 infectioncouldbeduetothedifferentgeneticbackgroundofthe
biologicalreplicates. individualpigs(LunneyandChen,2010).Withinaspecies,indi-
viduals can vary greatly in their resistance to infections, and a
Phenotypicgroup Samplesize Samplingtime-points(DPI)
major part of this variability maybe attributed to the variation
comparisons (n)
inthegeneticbackground(Ardiaetal.,2011).Severalresearchers
4 7 11
havereported geneticvariationinimmunetraitsinhealthypigs
HvHgvs.LvHg 20 0.84 0.86 0.37 (Clapperton et al., 2005, 2009; Flori et al., 2011). We believe
30 0.91 0.92 0.47 our baseline assessment is of particular importance since this
HvLgvs.LvLg 20 0.83 0.80 0.96 genetic backgroundcouldinfluence the response to the disease.
30 0.91 0.88 0.98 Consequently,accountingforpre-existingdifferentialexpression
HvHgvs.HvLg 20 0.77 0.88 NA shouldbeconsideredinfutureinfectionstudies.
30 0.86 0.94 0.45 We tested the interaction effect between weight gain and
LvHgvs.LvLg 20 0.55 0.42 0.62 VL onglobalgene expression. Frombreedingand management
30 0.63 0.51 0.70 perspectives, quantifying interaction effects at early time-points
wouldallowmakingtimelymanagementandselectiondecisions.
AllfourcontrastswerecomparedateachDPIandevaluatedforfuturesampling Consequently we concentrated on 4–14DPI for further analy-
withdesirablepower(>80%). ses. In addition, by considering early DPI we assured that the
NA, notavailable.Thealgorithmcouldnotreacharesult.
effect being evaluated was exclusively due to an initial infec-
tionstageandnottoareboundofthedisease(Boddickeretal.,
2012). Our results complement and extend those reported by
gene expression profiling experiments in three ways. First, we Petry et al.(2007) and Bates et al. (2008), who tested the inter-
focused on modeling individual biological variation of gene actionbetweenviralburdenandgeneticlineaswellasinfection
expression.Giventhatalongertermobjectiveistofindgenesfor status on gene expression. Petry et al. (2005) reported that pigs
diagnosisandprognosisofPRRSVinfection, wewereinterested from Nebraska Index Line, selected for improved reproductive
incharacterizingthevarianceofexpressionattheindividuallevel. traits, gained more weight than Hampshire × Duroc crossbred
The resulting scope of inference is different from that obtained pigsafterPRRSVinfection.Therefore,theweightgainandblood
usingpooled samples(Genini et al.,2008; Xiao et al.,2010a,b), viral level interaction effect we evaluated resembled the genetic
sinceourexperimentalandinferentialunitistheindividualani- line by viral burden interaction reported by Petry et al. (2007)
mal and not a pool of animals. Second, we used a blocked andBatesetal.(2008).Theseauthorsreportedsevengeneswith
reference design (Steibel and Rosa, 2005). In contrast to com- significantlinebyVLinteractioninlungorbronchiallymphnode
mon reference designs (Bates et al., 2008; Xiao et al., 2010a,b; expressionprofiles.Queryingexpressionlevelsforthesamegenes
Wysockietal.,2012),ourdesignallowedustouse0DPIsamples inourdataset,wefoundthatDDX3Y (DEADboxproteins,ATP-
asareference,andstill include0DPIintests, whichwasinstru- dependentRNAhelicase), aparalogofDDX3reported byBates
mentalinassessingbaselineeffectsbeforeinfection.Additionally, etal.(2008),wasalsoDEinbloodcells.
because of the design used to accommodate single cDNA sam- SignificantdifferencesinDDX3expressionoccurredbetween
ples, this study has the flexibility of incorporating future data lowandhighviralburdenpigsfromtheirNebraskaIndexLine,
for differential expression analysis. Third, we report on whole- butnotinHampshire×Durocline.Likewise,weobservedsignif-
genomeexpressionprofilingofbloodcellsfrominvivoinfected icantdifferences(p≤0.003)inDDX3Y expressioninHvHgvs.
pigs that complements existing results from studies using pul- LvHg,butnotinHvLgvs.LvLg,at14DPI,althoughthedirection
monaryalveolarmacrophages(PAM),bronchiallymphnodeand of change was opposite in our results (over-expressed in HvHg
lung (Petry et al., 2007; Bates et al., 2008; Genini et al., 2008; pigs)ascomparedtotheBatesetal.(2008)experiment.However,
Lunneyetal.,2010;Xiaoetal.,2010a;Zhouetal.,2011;Wysocki ourresultsareinagreementwiththosefromGeninietal.(2008)
et al., 2012). Furthermore, obtaining blood samples is simpler who reported up-regulation of a gene from the same family
and less invasive than sampling other tissues, thus simplifying (DDX17) in PRRSV infected PAM. Moreover, DEAD-box heli-
implementationofgenomicdiagnosticsinpigs,includinginsitu casesareinvolvedinallaspectsofRNAmetabolism.Specifically,
samplingatfarms. inhumansDDX3wasreportedtoparticipateininnateimmune
Wefirstassesseddifferentialexpressionat0DPIbetweenpigs signalingandtoenhanceanti-viralresponsesbypromotingIFN
allocatedtodifferentphenotypicgroups,andobservedeffectsthat production(Schroder,2010;Ulvilaetal.,2010).DDX3wasalso
could not be solely attributed to experimental infection or ran- reportedasatargetforviralmanipulation(Schroder,2010). Thus,
dom errors (Page et al., 2006). The individual baseline (0 DPI) the over-expression of DDX3 molecules in HvHg pigs could
differentialexpressionassessmentwasonlybrieflyreportedbefore be attributed either to a host anti-viral response or to a viral
(Ait-Ali et al., 2011), and using 0DPI correction has not been mechanismforreplication(Ulvilaetal.,2010).
reported.Thistypeofcorrectionwasnotusuallyaddressedeither Within the first objective of this study we also aimed to
because the baseline samples were pooled (Genini et al., 2008; characterize gene networks and individual genes influencing
Xiao et al., 2010a,b) or because they were omitted from the PRRSV immune response in the four phenotypic groups con-
expression experiment (Bates et al., 2008; Wysockiet al., 2012). sidered.Wefurtherevaluatedtranscriptswithexpressionsubject
Differencesingeneexpressionbetweenphenotypicgroupsbefore to significant VL by weight gain interaction effects to identify
FrontiersinGenetics|LivestockGenomics January2013|Volume3|Article321|8
Arceoetal. DifferentialgeneexpressiontoPRRSV
biologicalfunctionsassociatedwithrelevantmolecularnetworks. Overall,ourfindingsofDEgenesinwholebloodareinagree-
Wefocusedon4and7DPIsincetheseprovideinsightsonearly ment with previous reports on specific target tissues and cells,
hostanti-viralandinnateimmuneresponsetoPRRSVinfection suchaslungandPAM,followingPRRSVinfectionsandprovide
and they are candidate sampling time-points to be pursued in evidenceoftheimmuneresponseagainstapathogen.Changesin
futurestudies.Pathwayanalysisrevealedthatcelldeathfunction bloodtranscriptionalprofileswerereportedinhumanswithdif-
was significantly associated with several networks enriched for ferentnon-systemic infectious diseases(Chaussabeletal.,2010)
DEgenesat4and7DPI.Genesincludedinthesenetworksand and non-hematological disorders (Liew et al., 2006; Mohr and
associated with cell death were MERTK, GZMA, and PYCARD. Liew,2007).Comparisonoftheperipherialbloodexpressedtran-
All these genes followed a general pattern of under-expression scripts with expressed transcripts of different solid tissues in
in high VL compared to low VL pigs (FC ≤−1.5). An excep- humans,resultedin∼80%ofsharedtranscripts,andinthepos-
tion to this was HvLg vs. LvLg at 7DPI. These overall results tulation of this tissue as a surrogate tissue (Liew et al., 2006).
areconsistentwiththosefromGeninietal.(2008)thatreported More recently, Kohane and Valtchinov (2012) quantified and
inhibitionofapoptosisincelllines9–12hpostinfection.Results reportedahighoverlapbetweentranscriptswiththehighestlevels
obtained withourtype 2 isolateofPRRS virusarealsocompa- of expression in white blood cells and highly expressed tran-
rable to results obtained from piglets infected with a different scriptsinamixtureofothertissues.Therefore,evaluatingthehost
and highly pathogenic type 2 strain of the virus (HP-PRRSV) bloodtranscriptomeshouldprovideusefuldiagnosticand/ordis-
comparinggeneexpressiontouninfectedcontrolsat4and7DPI ease prognosis information (Liew et al., 2006; Mohr and Liew,
(Xiao et al., 2010b). Cell death is a host defense mechanism to 2007; Chaussabel et al., 2010). Since blood cells interact with
inhibitviralreplication(AlcamiandKoszinowski,2000).Overall, most body tissues, these cells reflect the state of other tissues
the global gene expression profile showed a trend where HvLg (KohaneandValtchinov,2012).Ourresultsstresstheusefulness
and HvHgpigs had lowerexpression ofthe listed genesrelative of our study for sampling the more accessible blood to reveal
to LvLg and LvHg pigs, respectively, indicating that the defense thecomplexityofhostresponsestoPRRSVinfection.Weexpect
mechanismmediatedbycelldeathhadreducedefficiency,thereby that our planned, more detailed studies will generate further
allowing increased viral replication. At 4DPI, our study iden- answersontheroleoftheseandmanyothergenesinanti-PRRSV
tified MERTK as DE and associated with cell death in HvHg responses.
vs. LvHg pigs. The product of MERTK is a phagocytic recep- Finally, our global differential expression results were used
tor that is involved in the clearance of apoptotic thymocytes. as pilot data to inform design of future time-course transcrip-
MousemacrophageslackingMERTK showedadelayedclearance tion profiling experiments. We evaluated different scenarios of
of apoptotic cells (Seitz et al., 2007). There have been no pre- sample sizes and sampling time-points for combinations given
vious reports of this gene identified as DE in PRRSV response a fixed total sampling effort. We concluded the best scenario
studies. for future studies consists of sampling at 4 and 7DPI using
Key genes in the swine leukocyte antigens (SLA) complex about 30 pigs per phenotypic group, and that a minimum of
have been well documented for their effects on production and 20 pigs per group are needed for controlling type I and type II
immunetraitsindifferentpigpopulations(Lunneyetal.,2009). errorratestoacceptablelevelsinmostcomparisons.Theresults
At7DPI,weidentified SLA-DRAsignificantlyover-expressed in obtained with a sample size n=30 were consistent with pre-
LvLgrelativetoLvHg.SLA-DQA1followedthesametrend, and vious results obtained from a dataset generated by Chen et al.
in addition, it was significantly under-expressed in LvHg and (manuscriptinpreparation).OurgroupusedtheWysockietal.
HvLgrelativetoHvHgandLvLg,respectively.Globaldifferential (2012)datasetoflungtissueexpressionat14DPItoevaluatesta-
expressionandfunctionalanalysiscomparingPRRSVinfectedto tisticalpowerofhighversuslowviralburdenpigs,andaffirmed
uninfected pigsat the samesamplingtime-points by Xiao et al. thatapproximatelythesamesamplesizewasneeded.Theseresults
(2010a) reported that MHC class II antigens (SLA-DQA, SLA- underscore the importance of computing sample size. We pre-
DMB, SLA-DQB1, and SLA-DRA) were significantly induced in dictthatthiscouldbeappliedinabroadercontext,forinstance,
PRRSVinfectedlungs. in next generation sequencing experiments. Such technology is
Our study identified IFNA1 as being significantly DE in all beingincreasinglyusedforevaluatingexpressionprofilinginpigs
contrasts but HvHg vs. LvHg at 4DPI. Specifically, at both infectedwithPRRSV(Xiaoetal.,2010a,b).Eventhoughwecould
4and7DPI,IFNA1wasover-expressedinHvHgandLvLgrela- expectlesstechnicalvariationinexpressionmeasuredwithRNA-
tive to HvLg and LvHg pigs, respectively. IFNA wasreported as seq (Marioni et al., 2008), biological variation would remain
under-expressed in PRRSV-infected with respect to uninfected unaffected. In such cases, the only way of increasing power of
PAM at 30 (Ait-Ali et al., 2011) but not at 12h post infec- the tests would be increasing the number of biological samples
tion (Genini et al., 2008). IFNA was reported under-expressed (Steibeletal.,2009b).
at 4 and 7DPI in lung tissue of infected pigs relative to unin- Evidence presented in this paper highlights the importance
fected controls (Xiao et al., 2010a) but at 14DPI, Lunney of thoughtful experimental design and accurate modeling. We
et al. (2010) reported no differences in expression in tracheo- acknowledge sample size is a key factor of every experiment
bronchial lymph node for several innate markers (IFNA, IL1B, and correct modeling of variation (biological and technical) is
and IL8). In addition, Petry et al. (2007) found that differ- essential. As a result, this experiment provided information on
ences in expression of IFNA were influenced by pig genetic actual sample sizes and sampling time-points needed for more
line. precise estimation of effects of interest. Our preliminary results
www.frontiersin.org January2013|Volume3|Article321|9
Arceoetal. DifferentialgeneexpressiontoPRRSV
have already identified differential gene expression, molecular ACKNOWLEDGMENTS
networksandbiologicalfunctionsaffecting thefourphenotypic ThisworkwassupportedbyUSDAARSfundingandUSDANIFA
groups of pigs and the influence of PRRSV infection. Finally, grant#2010-65205-20433.ThePRRSHostGeneticsConsortium
duetotheflexibleexperimentaldesignutilizedinthisstudy,the (PHGC) samples were supported through grants #07-233 and
resulting dataset can be merged with future data for increas- #09-244 from the U.S. National Pork Board. The authors
ingly powerful and precise inferences on response to PRRSV acknowledgethecarefulRNApreparationsperformedbyAmber
infection. JeanTietgensatBARC.
REFERENCES in pigs: heritability and associ- Galina-Pantoja, L., Mellencamp, M. Theperipheralbloodtranscriptome
Ait-Ali, T., Wilson, A. D., Carre, ations with performance under A., Bastiaansen, J., Cabrera, R., dynamically reflects system wide
W., Westcott, D. G., Frossard, different health status condi- Solano-Aguilar, G., and Lunney, J. biology:apotentialdiagnostictool.
J. P., Mellencamp, M. A., et al. tions. Genet. Sel. Evol. 41:54. doi: K. (2006). Relationship between J.Lab.Clin.Med.147,126–132.
(2011). Host inhibits replication 10.1186/1297-9686-41-54 immune cell phenotypes and pig Lunney, J. K., and Chen, H. (2010).
of European porcine reproduc- Collins, J. E., Benfield, D. A., growthinacommercialfarm.Anim. Genetic control of host resistance
tive and respiratory syndrome Christianson, W. T., Harris, L., Biotechnol.17,81–98. toporcinereproductiveandrespira-
virus in macrophages by altering Hennings,J.C.,Shaw, D.P.,etal. Genini,S.,Delputte,P.L.,Malinverni, torysyndromevirus(PRRSV)infec-
differential regulation of type-I (1992). Isolation of swine infer- R.,Cecere,M.,Stella,A.,Nauwynck, tion.VirusRes.154,161–169.
interferontranscriptionalresponse. tility and respiratory syndrome H. J., et al. (2008). Genome-wide Lunney, J. K., Fritz, E. R., Reecy, J.
Immunogenetics63,437–448. virus (isolate ATCC VR-2332) in transcriptionalresponseofprimary M.,Kuhar,D.,Prucnal,E.,Molina,
Alcami, A., and Koszinowski, U. North America and experimental alveolar macrophages following R., et al. (2010). Interleukin-8,
H. (2000). Viral mechanisms of reproductionofthediseaseingno- infectionwithporcinereproductive interleukin-1 beta, and interferon-
immune evasion. Immunol. Today tobioticpigs.J.Vet.Diagn.Invest.4, and respiratory syndrome virus. gamma levels are linked to PRRS
21,447–455. 117–126. J.Gen.Virol.89,2550–2564. virusclearance.ViralImmunol.23,
Ardia, D. R., Parmentier, H. K., and Cui, X. G., Hwang, J. T. G., Qiu, Holtkamp, D. J., Kliebenstein, J. B., 127–134.
Vogel, L. A. (2011). The role J., Blades, N. J., and Churchill, Neumann,E.J.,Zimmerman, J.J., Lunney,J.K.,Ho,C.-S.,Wysocki,M.,
of constraints and limitation in G. A. (2005). Improved statistical Rotto,H.,Yoder,T.K.,etal.(2012). andSmith,D.M.(2009).Molecular
driving individual variation in testsfordifferentialgeneexpression Assessmentoftheeconomicimpact genetics of the swine major his-
immune response. Funct. Ecol. 25, by shrinking variance components of porcine reproductive and respi- tocompatibility complex, the SLA
61–73. estimates.Biostatistics6,59–75. ratory syndrome virus on United complex.Dev.Comp.Immunol.33,
Bates,J.S.,Petry,D.B.,Eudy,J.,Bough, Dawson, H. D., Beshah, E., Nishi, States pork producers. J. Swine 362–374.
L., and Johnson, R. K. (2008). S., Solano-Aguilar, G., Morimoto, HealthProd.(inpress). Lunney, J. K., Steibel, J., Reecy, J.
Differentialexpressioninlungand M., Zhao, A. P., et al. (2005). Kimman, T. G., Cornelissen, L. A., M., Fritz, E., Rothschild, M. F.,
bronchiallymphnodeofpigswith Localizedmultigeneexpressionpat- Moormann,R.J.,Rebel,J.M.J.,and Kerrigan,M.,etal.(2011).Probing
highandlowresponsestoinfection ternssupportanevolvingTh1/Th2- Stockhofe-Zurwieden, N. (2009). genetic control of swine responses
withporcinereproductiveandres- likeparadigminresponsetoinfec- Challenges for porcine reproduc- to PRRSV infection: current
piratory syndrome virus. J. Anim. tions with Toxoplasma gondii and tiveandrespiratorysyndromevirus progressofthePRRShostgenetics
Sci.86,3279–3289. Ascaris suum. Infect. Immun. 73, (PRRSV) vaccinology. Vaccine 27, consortium.BMCProc.5:S30.doi:
Benjamini,Y.,andHochberg,Y.(1995). 1116–1128. 3704–3718. 10.1186/1753-6561-5-S4-S30
Controllingthefalsediscoveryrate Doeschl-Wilson, A. B., Kyriazakis, I., Kohane, I. S., and Valtchinov, V. I. Mardis, E. R. (2008). The impact of
-apracticalandpowerfulapproach Vincent, A., Rothschild, M. F., (2012).Quantifyingthewhiteblood next-generation sequencing tech-
tomultipletesting.J.R.Statist.Soc. Thacker, E., and Galina-Pantoja, cell transcriptome as an accessible nology on genetics. Trends Genet.
B57,289–300. L. (2009). Clinical and patholog- window to the multiorgan tran- 24,133–141.
Boddicker,N.,Waide,E.H.,Rowland, ical responses of pigs from two scriptome (vol 28, pg 538, 2012). Marioni, J. C., Mason, C. E., Mane,
R. R. R., Lunney, J. K., Garrick, geneticallydiversecommerciallines Bioinformatics28,905. S.M.,Stephens, M.,andGilad,Y.
D. J., Reecy, J. M., et al. (2012). to porcine reproductive and res- Lee, C., Bachand, A., Murtaugh, M. (2008).RNA-seq:anassessmentof
Evidence for a major QTL associ- piratory syndrome virus infection. P.,andYoo,D.(2004a).Differential technical reproducibilityandcom-
atedwithhostresponsetoporcine J.Anim.Sci.87,1638–1647. host cellgeneexpressionregulated parisonwithgeneexpressionarrays.
reproductive and respiratory syn- Done,S.H.,Paton,D.J.,andWhite,M. bytheporcinereproductiveandres- GenomeRes.18,1509–1517.
dromeviruschallenge.J.Anim.Sci. E.C. (1996). Porcine reproductive piratory syndrome virus GP4 and Mateu, E., and Diaz, I. (2008). The
90,1733–1746. andrespiratory syndrome (PRRS): GP5 glycoproteins. Vet. Immunol. challenge of PRRS immunology.
Chaussabel, D., Pascual, V., and areview,withemphasisonpatho- Immunopathol.102,189–198. Vet.J.177,345–351.
Banchereau, J. (2010). Assessing logical, virological and diagnostic Lee, C., Rogan, D., Erickson, L., Miller, L. C., and Fox, J. M. (2004).
the human immune system aspects.Br.Vet.J.152,153–174. Zhang, J., and Yoo, D. (2004b). Apoptosis and porcine reproduc-
through blood transcriptomics. Flori,L.,Gao,Y.,Laloe,D.,Lemonnier, Characterization of the porcine tiveandrespiratorysyndromevirus.
BMC Biol. 8:84. doi: 10.1186/ G., Leplat, J. J., Teillaud, A., reproductive and respiratory syn- Vet. Immunol.Immunopathol.102,
1741-7007-8-84 et al. (2011). Immunity traits drome virus glycoprotein 5 (GP5) 131–142.
Clapperton, M., Bishop, S. C., and in pigs: substantial genetic instablyexpressingcells.VirusRes. Mohr,S.,andLiew,C.C.(2007).The
Glass,E.J.(2005).Innateimmune variation and limited covaria- 104,33–38. peripheral-blood transcriptome:
traits differ between Meishan and tion. PLoS ONE 6:e22717. doi: Lewis, C. R., Ait-Ali, T., Clapperton, new insights into disease and risk
Large White pigs. Vet. Immunol. 10.1371/journal.pone.0022717 M.,Archibald,A.L.,andBishop,S. assessment. Trends Mol. Med. 13,
Immunopathol.104,131–144. Gadbury,G.L., Page,G.P.,Edwards, (2007).Geneticperspectivesonhost 422–432.
Clapperton, M.,Diack,A.B.,Matika, J. W., Kayo, T., Prolla, T. A., responses to porcine reproductive Page, G. P.,Edwards, J. W., Gadbury,
O., Glass, E. J., Gladney, C. Weindruch,R.,etal.(2004).Power and respiratory syndrome (PRRS). G.L.,Yelisetti,P.,Wang,J.,Trivedi,
D., Mellencamp, M. A., et al. andsamplesizeestimationinhigh ViralImmunol.20,343–358. P., et al. (2006). The poweratlas:
(2009). Traits associated with dimensionalbiology.Stat.Methods Liew,C.C.,Ma,J.,Tang,H.C.,Zheng, a power and sample size atlas for
innate and adaptive immunity Med.Res.13,325–338. R., and Dempsey, A. A. (2006). microarrayexperimentaldesignand
FrontiersinGenetics|LivestockGenomics January2013|Volume3|Article321|10