Table Of ContentA new photopolymer based VPHG for astronomy: The case of SN
2013fj
Alessio Zanutta, Marco Landoni, Andrea Bianco
4
1 INAF - Osservatorio Astronomico di Brera, Via Emilio Bianchi 46, I-23807 Merate, Italy
0
2
Lina Tomasella, Stefano Benetti, Enrico Giro
n
a INAF - Osservatorio Astronomico di Padova, Vicolo dell’Osservatorio 5, I-35122 Padova, Italy
J
1
3
] ABSTRACT
M
The spectroscopic studies of near infrared emission arising from supernovae allow to derive
I
. crucialquantitiesthatcouldbettercharacterisephysicalconditionsoftheexpandinggas,suchas
h
p the CaII IR HVF spectral feature. For this reasonis mandatory to have Diffractive Optical Ele-
- ments(DOEs)withaspectralcoverageinthe range8000- 10000˚A(for lowzsources)combined
o
withareasonableSignaltoNoiseRatio(S/N)andmedium-lowresolution. Inorderto copewith
r
t all of those requirements we developed a Volume Phase Holographic Grating (VPHG) based on
s
a aninnovativephotosensitivematerial,developedbyBayerMaterialScience. Wedemonstratedthe
[ capabilitiesofthisnewDOEthroughobservationofSN2013fjascasestudyatAsiagoCopernico
Telescope where AFOSC spectrograph is available.
1
v
Subjectheadings: SupernovaeIa;extragalacticastronomy;volumephaseholographicgrating;photopoly-
5
mers; grism
1
0
0 1. Introduction a periodic modulation (usually sinusoidal) of the
. refractive index written in the holographic ma-
2
Astronomicalspectrographsarekeyinstrumen-
terial. Hence the fundamental parameters that
0
tationtotackletheopenissuesinastronomy. One
4 rule the overall efficiency of such devices are
1 of the most important element along with the the thickness of the active film and the modu-
: detector is the dispersing element. In the last lation of the refractive index inside it. VPHG
v
15 years, the Volume Phase Holographic Grating
i technology has been applied in different astro-
X (VPHG) technologyhasgaineda lotofinterestin
nomical spectrographs, at room and cryogenic
r astronomical field and it has been used in some temperatures (Bershady et al. 2008; Arns et al.
a
spectrographs (Baldry et al. 2004; Bianco et al.
2010; Molinari et al. 2004; Lepine et al. 2003;
2012; Barden et al. 2000; Pazder & Clemens
Hou et al. 2010; Renault et al. 2010; Hill et al.
2008). The reasons for such interest stem from
2008). Theyhavealsobeenusedastuneablefilters
the fact that these gratings show unique features,
and cross dispersers (Mendes de Oliveira et al.
such as i) the high peak efficiency (up to 100%
2013; Gibson et al. 2012; Castilho et al. 2004).
theoretically) both at low and large dispersion;
The VPHGs assembledin aGRISM configuration
ii) the ease of performance tuning and customisa-
have been also used in this kind of instrumenta-
tion (each VPHG is a master grating). A VPHG
tion. The availability of a low resolution grism
consists in a thin layer of holographic material,
covering the red part of the optical spectrum is
usuallydichromatedgelatine(Bianco et al. 2012;
of paramount importance for several astrophysi-
Barden et al. 2000),whichissandwichedbetween
cal targets, among which stands out the study of
two glass windows. The phase of incident light is
supernovae in general and type Ia supernovae in
modified passing through the gratings thanks to
1
particular. Sucha grismwill characterisethe evo- FOCAS (Ebizuka et al. 2011a,b). Starting from
lution of important lines during the photospheric the scientific case of the SN 2013fj hereinafter we
(e.g. O I 7774 ˚A and Ca II IR triplet), and the demonstrate the capabilities in terms of spectral
nebular phases (e.g. Ca II] 7291-7323 ˚A and Ca resolution and throughput of this new family of
II IR triplet). VolumePhaseHolographicGrating,basedonpho-
Particularly important will be to study the evo- topolymers, comparing two spectra of SN 2013fj
lution in type Ia supernovae of the high velocity in which one of them is secured by the adop-
features (HVFs) seen in the Ca II triplet pro- tion of previous existing state of the art grating.
file, especially at early,pre-maximum,phases (see Throughoutthispaperwerefertothisnewgrating
Childress et al. 2014, for a recent review). The as VPH6.
origin of the HVFs remains unknown, but dif-
ferent hypotheses have been proposed, which in- 2. Observations and data reduction
clude the impact of the ejecta with a circumstel-
We obtained the spectrum of SN 2013fj in
lar shell lost by the progenitor before the explo-
visitor mode at Ekar Asiago Observatory using
sion (see Gerardy et al. 2004); an enhancement
the Asiago Faint Object Spectrograph Camera
in the abundance of intermediate-mass elements
(AFOSC) on 13th September 2013. The seeing
(IMEs) in the outermost layers of SN Ia ejecta
′′
during the night was quite constant (2.0 - 2.2 )
(Mazzali et al. 2005a,b; Tanaka et al. 2008); or
and the sky was almost clear during the obser-
variations in the ionisation state of IMEs in the
vations. In order to compare the new VPH6 de-
outerlayersofSNIaejecta(Blondin et al. 2013).
vice performance, we took two spectrum of the
It is evident that the study of the Ca II HVFs
SN 2013fj. The first one was been obtained con-
could have a big impact in deriving the true pro-
figuring the instrument with the GRISM GR04,
genitor scenario involved in the SNIa explosion,
yielding a dispersion of ∼ 5 ˚A px−1 and R ∼ 600
which in turn could have important implication
in the spectral range 3500-7500 ˚A. The spectra
in the use of SNIa in Cosmology. Moreover, the
obtained with the new VPH6 GRISM, which was
circumstellar (CS) material responsible for the
been secured immediately after the previous one,
HVFs could cause subtle alteration of the spec-
yields a dispersion of ∼ 3.5 ˚A px−1 and R ∼ 500.
tralenergydistributionofSNIa,whichcouldhave
We adopted a slit of 1.69′′ × 5.00′′ for both spec-
possible consequences in the luminosity standard-
tra.
ization of SNIa (Childress et al. 2014).
Since the Supernova Program has many observa-
In order to accomplish the desired requirements
tionprioritiesscheduledforAFOSC,wedecidedto
we designed and manufactured a VPHG based
firstsecureaspectrumwiththe wellknownGR04
on a completely new holographic material. The
grating (this was done to guarantee the data for
study ofthis newmaterial,otherthandichromate
the requiredscientific tasks). After that we coped
gelatins (DCGs), is very important in order to
to obtain another observation of the same target
make possible the design and manufacturing of
(SN2013fj),underthesameskyconditions,reduc-
innovative and large VPHGs. Indeed DCGs are
ingthetelescopetimethatwouldbeotherwisenot
difficult to handle, they require a complex chem-
allocated for the other targets in the night. The
ical process and the scalability to very large size
integration time for the spectrum obtained with
gratings can be an issue. For this reasons we fo-
VPH6 was 1200s while for the GR04 was 1800s.
cused the attention to solid photopolymers which
Foreachexposurewereduceddataadoptingstan-
combines high throughput, high refractive index
dard IRAF1 procedure. We performed bias sub-
modulation, self developing (i.e. no chemical pro-
tractionandflatfieldcorrectionfor eachscientific
cesses needed) and size scalability. Such new ma-
frame adopting calibration obtained in the same
terial belongs to the class of solid photopolymers
night. The wavelength calibration was achieved
and this is the first time, in our knowledge, that
this kind of holographic material has been used
1IRAF (Image Reduction and Analysis Facility) is dis-
to make scientific grade dispersing elements. In
tributedbytheNationalOpticalAstronomyObservatories,
thepastonlyliquidphotopolymershavebeenused
which are operated by the Association of Universities for
oncetoproduceVPHGsmountedinMOIRCSand ResearchinAstronomy,Inc.,undercooperativeagreement
withtheNationalScienceFoundation.
2
using the spectra of standard arcs (Th-Ar and 2.1. The device VPH6 at AFOSC
Hg-Cd) while flux calibration has been assessed
The GRISM consists in a photopolymer based
through relative photometric calibration of stan-
Volume Phase Holographic Grating (VPHG) (see
dard stars spectra (Oke 1990) obtained in the
Table 1 for the GRISM features and require-
same night (BD+33d2642). The accuracy on
ments). The solid photopolymer used in this
wavelength calibration is ∼ 0.5 ˚A rms for the
device has been recently developed by Bayer
VPH6 and ∼ 0.2 ˚A rms for the GR04. MaterialScience AG (product family: Bayfol(cid:13)R
ThetwoRMSvaluesfortheaccuracyonthewave-
HX) as high performance holographic material
length calibration are quite different since in the
(Bruder et al. 2010), for reflection holograms.
red partof the spectrum few comparisonlines are
Thematerialisalsosuitablefortransmissionholo-
available due to the calibration lamps installed in
grams with high dynamic range and sensitivity.
theAFOSCspectrograph. Thecalibrationismore
Moreover the material is laminated onto flexible
accurate in the blue because more emission lines
and transparent substrates of large sizes. The
in thatpartof the spectrum wereusable. For this
grating is a ”low dispersion” device with a line
reason, the two RMS are slightly different. How-
density of 285 lines mm−1 with a targetefficiency
ever,it is alsoimportant to note that the two val-
of 90% at the central wavelength.
ues are far below the resolution power of the two
It can be seen that this low dispersion grating,
gratings. TheapparentRmagnitudeobtainedwas
combinedwithasuitablewavelengthrange,allows
17.2 ± 0.2. We cross checkedthe calculated value
tocoverstheHαregionandtheCaIbumptypical
throughanaperturephotometryoftheRbandac-
ofSNspectra. Thedesignofthegratingwasaimed
quisitionimage ofthe field(see Figure 1), secured
at finding the best key parameters (film thickness
just before obtaining the spectra.
and refractive index modulation) matching the
scientific requirements, i.e. diffraction efficiency,
wavelength coverage, and resolution. This activ-
ity has been performed through RCWA simula-
tions2 (M. Moharam and T. Gaylord 1981). We
havethereforeidentifiedthebestcoupleofparam-
eters(∆n=0.011andd=34µm). Thequitelarge
thickness and small modulation of the refractive
index is chosen in order to reduce the efficiency
inordershigherthanthe first,whichisa common
featureoflowlinedensityVPHGs. InFigure2are
reported the simulated 1-st order diffraction effi-
ciency curves for different values of ∆n and film
thickness. In the inset A) are reported the curves
at different film thickness with with a fixed value
of ∆n = 0.011. Shown curves have ± 10 % from
the chosen value of 34 µm. In the inset B) are re-
portedthecurvesatdifferent∆nwithwithafixed
thickness d = 34 µm. Shown curves have ± 10 %
fromthechosenvalueof0.011. Thephotosensitive
Fig. 1.—RBandimageofFoVaroundSN2013fj. film was laminated onto a BK7 substrate before
Theplatescaleoftheimageis18.59′′px−1. Expo- the exposure; the writing procedure was accom-
sure time is 120s. Seeing during the observation, plished using a standard two-beams holographic
taken at airmass 1.17 and measured on the image setup with a DPSS laser of 532 nm. The tar-
′′
of the field, is 2.2 . The host galaxy of SN 2013fj get refractive index modulation has been reached
is also clearly visible. optimising the writing laser power since the fi-
2RCWAcode,writteninC,wasprovidedbyGaryBernstein,
whoimplementedthemethods ofMoharam&Gaylord.
3
Table 1
AFOSC’s GRISM VPH6: main specifications and requirements
λcentral [nm] linesmm−1 ∆λ[nm] ηpeak ηside
(1) (2) (3) (4) (5)
800 285 620-980 90% 30%
Note.—Descriptionofcolumns: (1) Workingcentralwavelengthofthegrating;(2) Pitchofthegrating; (3)Wavelengthrange;(4)
1-storderdiffractionefficiencyatthepeakwavelength;(5)1-storderdiffractionefficiencyatthewavelengthrangeedges.
nal achieved∆n strongly depends upon the expo-
sure power density as reported by Berneth et al.
°
A) 1−st order diffraction efficency curves @ 4.4
(2011). different film thickness and fixed ∆ n
1
Regarding the GRISM, the apex prism angle
has been designed in order to maintain the 1-st
0.8
order central undieviated wavelength at 800 nm.
◦
TheresultwasaBK7prismwithanangleof12.7 T
tinhgatofco4r.r4e◦s.pond at an entrance angle in the grat- ciency − 1 00..46 333047. .µ64 µµm mm
The grating was then coupled with the prisms us- effi
ing a refractive index matching oil. In order to
0.2
characterise the device, we measured the diffrac-
tion efficiency of the GRISM. The measurements
0
werecarriedoutusinglaserlightatdifferentwave- 0.5 0.6 0.7 0.8 0.9 1
λ [µ m]
lengths, setting the p- or s- polarisation and col-
lecting the efficiency of the first order as function °
B) 1−st order diffraction efficency curves @ 4.4
of the incidence angle; two efficiency curves are different ∆ n and fixed thickness
1
reported in Figure 3.
It can be seen that the efficiency is very high
0.8
even with the prisms coupled with the VPHG in
the GRISM structure. This is achievable thanks T
to the AR-coating onto the prisms surfaces and y − 1 0.6 0.0099
c 0.011
n
the use of the same substrate material for both cie 0.4 0.0121
the prisms and grating windows, that avoids fur- effi
ther reflection losses. We lastly report in Figure
0.2
4 the measured1-storderdiffractionefficiency vs.
wavelengthoftheGRISMalignedandmountedin
0
his housing. 0.5 0.6 0.7 0.8 0.9 1
λ [µ m]
It is clear that the final alignment is crucial to
maintain the requirements satisfied since even a
tilt of a few degrees have a huge impact on the
Fig. 2.— Simulated 1-st order diffraction effi-
efficiency curve.
ciencycurves,withRigorousCoupledWaveAnal-
ysis; A) curves for different thickness (d = 34 µm
3. Results
± 10 %) and fixed ∆n = 0.011; B) curves for dif-
After the commissioning of the new VPH6 for ferentrefractiveindex modulation(∆n = 0.011±
AFOSC at 1.82m Copernico telescope, we taken 10 %) and d = 34 µm . The considered incidence
◦
two exposures of a flat field lamp with the same angle is 4.4 (on the grating interface).
exposuretimebutvaryingthegratingsinorderto
4
have a sound comparison of the two overall effi-
ciencies. In particular, as shown in Figure 5 the
Wavelength = 808 nm spectra of the lamp represents the behaviour of
1
φ
1−st order diffraction efficiency0000....2468 max = 89% φmspean φ tttfsohhotarreeT,rtitchnshionlaseimgttnrstpkufwasrlmooorsetmesodenxta∼gtp,nhroiadne5stu8itthn0reeeog0rlesmmss˚A.icostogotpiehfseneeepffitonohuucsrsismoeiubncbglcoeehynrptfiooougfftuti,cnrhoaafeeutdridnooetpntsthteeaiocdnt-f
0
−15 −10 in−c5idence angle α [gr0ad] 5 10 the spectrum of the new device (red curve) is sig-
nificantly higher than those obtained in the case
Wavelength = 633 nm of the GR04 (blue curve). Moreover the spectral
1
1−st order diffraction efficiency0000....2468 max = 78% φφmspean φ ae(TwcTroshitvtoierheemerswqaatuogehsilfeeerlletlovahdVfiesetPiihtnbtHealaeo6rlV.rgfdPerwiet2Hnaer0sgd61tino4cios)gob.imenjoxevpfcteatetsnrhtfeideogderafldtwatehutietpnfiheSetaloNtdrh∼IerpRer9coo5opng0rrerd0oaepom˚Ad-f
−01 5 −10 −5 0 5 10 the GR04 after the signal normalisation; the re-
incidence angle α [grad]
sult was a comparable fringe pattern, reassuring
us that the effect can be attributed only to the
Fig. 3.— Measured 1-st order diffraction efficien- CCD as described in the AFOSC’s manual. 3
cies of the GRISM at 808 nm and 633 nm. The
datarepresentthep-polarisationefficiencyφ ,the
p
s-polarisationefficiencyφ andtheresultingmean
s
φ, as function of the incidence angle α in air.
1
0.9
0.8
1−st order diffraction efficiency00000.....34567 0−+°11°° Fig. 5.— Comparison of flat fields of VPH6 (red
0.2 line) and GR04 (blue line) obtained at AFOSC
adopting homogeneous configuration of the sys-
0.1
tem.
0
600 650 700 750 800 850 900 950 1000
wavelength [nm]
In order to assess the capabilities of the new
Fig. 4.—Measured1-storderdiffractionefficiency grating in terms of scientific goals, we performed
curve of the alignedGRISM at different incidence observations of SN 2013fj that has been al-
angles. The angle 0◦ refers to the perpendicular ready discovered by the amateur astronomers
to the grating inside the GRISM.
3The entire manual of AFOSC is available at
http://archive.oapd.inaf.it/asiago/5000/5100/man01_2.ps.gz
5
Fig. 6.— Spectra of SN 2013fj taken with AFOSC and GR04 (blue line) and with VPH6 (red line). The
principal lines of Si II, Ca II, S I, Mg II and Fe II are shown.
6
are the Ca II near-IR triplet. Despite contamina-
tion from the 7600 ˚A telluric feature, O I 7774 ˚A
is clearly visible.
Adopting for the host galaxy (CGCG 428-62) of
SN 2013fj a recessional velocity of 10064 km s−1,
Huchra et al. (1999), an expansion velocity of
about10700kms−1isdeducedfromtheSiII6355
˚Aabsorption,whilefromtheCa-IIIRtripletmini-
mumanexpansionvelocityofabout11500kms−1
is deduced (the velocity is relative to the average
Ca-II IR triplet wavelength, 8579.1 ˚A). This be-
Fig. 7.— Comparison of the SN 2013fj spectrum haviouristypicallyseeninSNIa,wherethestrong
with that of phase +5 days from B maximum of CaII lines are formed well above the photosphere,
SN1992AmadeusingtheGELATOtool;GEneric which is better traced by the weaker S-II lines
classification Tool by Harutyunyan et al. (2008). (from which a mean expansion velocity of about
GELATO is a software for objective classification 8400 km s−1 is deduced).
of Supernova spectra and performs an automatic The CaII-IRhigh velocityfeature is by this phase
comparisonofagivenspectrumwithasetofwell- very weak, see Mazzali et al. (2005b), but pos-
studied SN spectra templates. Spectra of all SN sibly still visible as a weak absorption at about
types fromPadova-AsiagoSNArchiveareusedas 23000 km s−1
templates for the comparison procedure. The expansion velocity deduced from the S-II
6355 ˚A minimum most probably places SN 2013fj
among the low velocity gradient type Ia super-
Ciabattari et al. (2013) members of the Ital-
novae, following Benetti et al. (2005).
ian Supernovae Search Project on 7th Septem-
Inorderto makeasoundcomparisonbetweenthe
ber 2013. The spectra reported in Figure 6 has
two different dispersive elements, we evaluated
been obtained 6.07 days later and is that typi-
the S/N (Signal to Noise Ratio) at 6 different
cal of a Type Ia supernova, about 5±2 days after
wavelengths along the two obtained spectra. The
maximum light (see Figure 7), confirming the es-
results are reported in Table 2 where S/N of the
timated phase reportedby Zanutta et al. (2013),
GRISMshavebeennormalisedadoptingtheusual
and derived from a fast reduction performed at
S/N equation (Howell et al. 2006) taking into ac-
the telescope of the same data.
count the different exposure times.4
The recorded spectrum, reported in Figure 7 and
analysedwithGELATO,isthecombinationofthe
spectra taken with the new VPH6 and the 3500-
4. Conclusions
4750˚AregionoftheGR04(sincetheywelloverlap
in the whole common range). This decision has We demonstrated the good performances ob-
been made because of the evident better Signal tainable by using a Volume Phase Holographic
to Noise Ratio of the VPH6 and the higher cov- Grating based on new photopolymer materials
erage in the red region where the the important which are self developing, characterisedby a high
featuresofthetargetobjectare(suchasHVFCa- sensitivityanddynamicrangeinconjunctionwith
II IR). The spectrum exhibit the broad P-Cygni an easy processability. The GRISM has been de-
lines typical of SNe Ia: the characteristic deep signed and manufactured in order to maximise
absorption near 6150 ˚A due to Si II 6347, 6371 the efficiency reducing the reflection losses. For
˚A (hereafter Si II 6355 ˚A), the Si II 5958, 5979 these reasons such devices are a reliable alterna-
˚A feature (hereafter Si II 5972 ˚A), the W-shaped tive to classical VPHGs. We assessed the scien-
feature near5400˚Aattributedto SII 5468˚Aand
S II 5640 ˚A. 4Fortherenormalisationweassumedthattheequationsim-
Other prominent features are Ca II H&K, Mg II plifiestoS/N =√s(wheresisthesignalfromthesource)
4481 ˚A, and several blends due to Fe II and Si II. sinceothernoises(suchasdarkcurrentordetectorreadout
noise)arenegligibleatthislevelofcomparison.
At red wavelengths, particularly strong features
7
Table 2
Signal to Noise Ratio comparison between the two GRISMs
Wavelength[˚A] S/NofVPH6 S/NofGR04
5000 22 17
5500 42 27
6000 45 27
6500 57 27
7000 38 20
7500 30 13
Note.—TheS/NofthetwoGRISMshavebeennormalisedaccordingtotherespectiveexposuretimes.
tific requirements which drawn the design of this
new DOE by collectingthe spectrum ofthe newly
discovered SN Ia PSN J22152851+1534041= SN
2013fj. Wefinallycarriedoutasoundcomparison
with another spectrum of the same object under
the same conditions, secured with the standard
grismthatischaracterisedby the samedispersion
and resolution.
Acknowledgements
We are grateful to: Dr. Thomas F¨acke of Bayer
MaterialScience for providing the material and
for the useful discussions; The technicians at mt.
Ekar for all the support during commissioning
basedonobservationscollectedatCopernicotele-
scope (Asiago, Italy) of the INAF - Osservatorio
Astronomico di Padova; L.T. and S.B. are par-
tially supported by the PRIN-INAF 2011 with
the project ”TransientUniverse: from ESO Large
to PESSTO”.
8
REFERENCES Harutyunyan et al. 2008, A&A, 488, 383
Arns, J., Wilson, J. C., Skrutskie, M., et al. 2010, Hill, G. J., MacQueen, P. J., Smith, M. P., et al.
Proc. SPIE, 7739 2008,Proc. SPIE, 7014
Baldry, I. K., Bland-Hawthorn, J., & Robertson, Hou, Y., Zhu, Y., Hu, Z., Wang, L., & Wang, J.
J.G.2004,Publ.Astron.Soc.Pacific.,116,403 2010,Proc. SPIE, 7735
Barden, S. C., Arns, J. A., Colburn, W. S., & Howell, S. B., Ellis, R., Huchra, J., et al. 2006,
Williams, J. B. 2000, PASP, 112, 809 Handbook of CCD astronomy, 2nd ed., by
S.B. Howell. Cambridge observing handbooks
Benetti, S., Cappellaro, E. , Mazzali, P.A., Tu-
for research astronomers, Vol. 5 Cambridge,
ratto,M.,Altavilla,G.,Bufano,F.,Elias-Rosa,
UK: Cambridge University Press, 2006 ISBN
N., Kotak, R., Pignata, G., Salvo, M., Stani-
0521852153
shev, V. 2005,ApJ, 623, 1011
Huchra et al. 1999, A.Ap. Suppl., 121, 287
Berneth, H., Bruder, F. K., F¨acke, T., Hagen, R.,
Ho¨nel, D., Jurbergs, D., Ro¨lle, T., & Weiser, Lepine, J. R. D., de Oliveira, A. C., Figueredo,
M.-S. 2011, Proc. SPIE, 7957, 79570H M. V., et al. 2003,Proc. SPIE, 4841, 1086
Bershady, M., Barden, S., Blanche, P.-A., et al.
Mazzali,P.A.,Benetti, S.,Stehle,M., etal.2005,
2008,Proc. SPIE, 7014
MNRAS, 357, 200 Paper A.
Bianco,A., Pariani,G., Zanutta,A., &Bertarelli,
Mazzali, P. A., Benetti, S., Altavilla, G., et al.
C. 2012, Proc. SPIE, 8450
2005,ApJ, 623, L37 Paper B.
Blondin, S., Dessart, L., Hillier, D. J., &
Mendes de Oliveira, C., Taylor, K., Quint, B., et
Khokhlov, A. M. 2013, MNRAS, 429, 2127
al. 2013, PASP, 125, 396
Bruder, F.-K., Deuber, F., F¨acke, T., Hagen, R.,
Moharam,M. & Gaylord,T. 1981,JOSA, 71,811
Ho¨nel, D., Jurbergs, D., Ro¨lle, T., & Weiser,
M.-S. 2010, Proc. SPIE, 7619, 76190I Molinari,E.,Bianco,A.,Bertarelli,C.,etal.2004,
Proc. SPIE, 5494, 228
Cardelli, J. A., Clayton, G. C., & Mathis, J. S.
1989,ApJ, 345, 245 Oke, J. B. 1990,AJ, 99, 1621
Castilho, B. V., Delabre, B., & Gneiding, C. D. Pazder,J.S., & Clemens, J. C. 2008,Proc.SPIE,
2004,Proc. SPIE, 5492, 433 7018
Childress, M. J., Filippenko, A. V., & Gane- Renault, E., Loupias, M., Adjali, L., et al. 2010,
shalingam,M.,&SchmidtM.J.2014,MNRAS, Proc. SPIE, 7739
437, 338
Tanaka,M.,Mazzali,P.A.,Benetti,S.,etal.2008,
Ciabattari,F.,Mazzoni,E.,Parker,S.,etal.2013, ApJ, 677, 448
Central Bureau Electronic Telegrams, 3654,1
Tomasella et al. 2014, Astron. Nachrichten, in
Ebizuka, N., Ichiyama, K., Yamada, T., et al. preparation
2011,PASJ, 63, 605
Zanutta et al. 2013, CBET 3654
Ebizuka,N.,Kawabata,K.S.,Oka,K.,etal.2011,
PASJ, 63, 613
Gerardy, C. L., Ho¨flich, P., Fesen, R. A., et al.
2004,ApJ, 607, 391
Gibson, S., Barnes, S. I., Hearnshaw, J., et al. This2-columnpreprintwaspreparedwiththeAASLATEX
2012,Proc. SPIE, 8446 macrosv5.2.
9